Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
R01 Count 5
Funding $543,216.67
PubMed Score 14.51
PubTator Score 14.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.897 0.000
atypical teratoid / rhabdoid tumor -1.800 0.000
pancreatic ductal adenocarcinoma liver m... -1.378 0.003
interstitial cystitis -1.100 0.001
aldosterone-producing adenoma -1.068 0.014
spina bifida -1.208 0.045
ovarian cancer 1.600 0.001

Gene RIF (9)

PMID Text
25448600 miR-199a-3p may function as a novel tumor promoter in gastric cancer and its oncogenic activity may involve the direct targeting and inhibition of ZHX1
24941917 High-quality solution NMR structures of three homeodomains from human proteins ALX4, ZHX1 and CASP8AP2 were solved.
24064680 Low expression of ZHX1 may be responsible for hepatocarcinogenesis.
23686912 Study showed that ZHX1 is SUMOylated by Ubc9 with SUMO1 at the sites K159, K454, and K626 and that the SUMOylation of ZHX1 regulated the stability, ubiquitination and transcriptional activity of ZHX1.
19348505 structure of the tandem zinc-finger region of human ZHX1
17303076 ZHX1 enhanced the transcriptional repression mediated by DNMT3B when DNMT3B is directly targeted to DNA. These results showed for the first the direct linkage between DNMT and zinc-fingers homeoboxes protein, leading to enhanced gene silencing by DNMT3B
17056598 ZHX proteins 1, 2 and 3 are major transcriptional mediators of podocyte disease
12659632 a search of ZHX1-interacting proteins using a yeast two-hybrid system
12237128 This study characterized features of ZHX-1 involved in nuclear localization, dimerization, and transcriptional activity, and mapped these domains.

AA Sequence

MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGY      1 - 70
ECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNN     71 - 140
QTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISKTPIMKMMKNKVENKRIAVHHNSVEDVPEEK    141 - 210
ENEIKPDREEIVENPSSSASESNTSTSIVNRIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVL    211 - 280
IPVNSIPTYNAALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEE    281 - 350
ARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV    351 - 420
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPH    421 - 490
DSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIIDSSDETTESPTVGTAQPKQS    491 - 560
WNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKM    561 - 630
EIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLA    631 - 700
RTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWD    701 - 770
RGPSLIKFKTGTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE    771 - 840
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD                                         841 - 873
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25448600 2014 MiR-199a-3p promotes gastric cancer progression by targeting ZHX1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24941917 2014 Solution NMR structures of homeodomains from human proteins ALX4, ZHX1, and CASP8AP2 contribute to the structural coverage of the Human Cancer Protein Interaction Network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24064680 2013 Construction of a recombinant eukaryotic human ZHX1 gene expression plasmid and the role of ZHX1 in hepatocellular carcinoma.
23686912 2013 The SUMOylation of zinc-fingers and homeoboxes 1 (ZHX1) by Ubc9 regulates its stability and transcriptional repression activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20509910 2010 Novel structural features in two ZHX homeodomains derived from a systematic study of single and multiple domains.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...