Property Summary

NCBI Gene PubMed Count 29
PubMed Score 15.61
PubTator Score 14.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
aldosterone-producing adenoma -1.068 1.4e-02
atypical teratoid / rhabdoid tumor -1.800 1.1e-04
interstitial cystitis -1.100 9.5e-04
osteosarcoma 1.161 1.3e-02
ovarian cancer -1.100 4.6e-03
pancreatic ductal adenocarcinoma liver m... -1.378 3.3e-03
spina bifida -1.208 4.5e-02

Gene RIF (12)

AA Sequence

MASRRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPVENTRAESISSDEEVHESVDSDNQQNKKVEGGY      1 - 70
ECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEHNLKYHPGEENFKLTMVKRNN     71 - 140
QTIFEQTINDLTFDGSFVKEENAEQAESTEVSSSGISISKTPIMKMMKNKVENKRIAVHHNSVEDVPEEK    141 - 210
ENEIKPDREEIVENPSSSASESNTSTSIVNRIHPSTASTVVTPAAVLPGLAQVITAVSAQQNSNLIPKVL    211 - 280
IPVNSIPTYNAALDNNPLLLNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEE    281 - 350
ARRKQFNGTVHTVPQTITVIPTHISTGSNGLPSILQTCQIVGQPGLVLTQVAGTNTLPVTAPIALTVAGV    351 - 420
PSQNNIQKSQVPAAQPTAETKPATAAVPTSQSVKHETALVNPDSFGIRAKKTKEQLAELKVSYLKNQFPH    421 - 490
DSEIIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCLHLNNDSSTTIIIDSSDETTESPTVGTAQPKQS    491 - 560
WNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKM    561 - 630
EIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLA    631 - 700
RTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWD    701 - 770
RGPSLIKFKTGTAILKDYYLKHKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDE    771 - 840
VIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD                                         841 - 873
//

Text Mined References (37)

PMID Year Title