Property Summary

NCBI Gene PubMed Count 38
PubMed Score 344.54
PubTator Score 115.60

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 3.700 1.3e-04
ependymoma 1.100 1.2e-02

Gene RIF (25)

AA Sequence

MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDF      1 - 70
GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELC     71 - 140
SLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK                                      141 - 176
//

Text Mined References (39)

PMID Year Title