Property Summary

NCBI Gene PubMed Count 37
Grant Count 16
R01 Count 2
Funding $3,906,906.77
PubMed Score 338.28
PubTator Score 115.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group A ependymoma 1.700 0.002
atypical teratoid/rhabdoid tumor 3.800 0.000

Gene RIF (25)

PMID Text
26950422 results demonstrate that blocking doppel can control VEGF signaling in TECs and selectively inhibit tumor angiogenesis.
22453181 The association between the APOE, CYP46, PRNP and PRND genes and the profile of neuropsychiatric symptoms in Polish subjects with Alzheimer's disease and mild cognitive impairment, was evaluated.
20981146 in astrocytomas, Dpl undergoes different molecular processes that might constitute additional helpful tools to characterize the glial tumor progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19728151 Cytotoxicity induced by the expression of Dpl and truncated PrP in neural derived cells are closely related with the apoptosis process.
19363267 From the logistic regression ananlsis of this stidy showed that the highest risk for was found for Alzheimer's disease individuals who co-inherited APOE epsilon4 allele, PRNP codon 129 homozygosity, PRND codon 174 Thr allele, and CYP46 rs754203 g allele.
19363267 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19129949 results suggested that the function of Dpl is antagonistic to PrP rather than synergistic
18936526 Results might suggest a potential and functional role for Dpl in tumor cells migratory and morphological behaviours and address to future gene-targeted therapeutic interventions.
17894227 Study provides the foundation for further study of Dpl biological functions in vitro and in vivo.
More...

AA Sequence

MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDF      1 - 70
GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELC     71 - 140
SLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK                                      141 - 176
//

Publication (37)

PMID Year Title
26950422 2016 Targeting prion-like protein doppel selectively suppresses tumor angiogenesis.
22453181 PRND 3'UTR polymorphism may be associated with behavioral disturbances in Alzheimer disease.
20981146 2010 Biochemical signatures of doppel protein in human astrocytomas to support prediction in tumor malignancy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19728151 2010 Transient expressions of doppel and its structural analog prionDelta32-121 in SH-SY5Y cells caused cytotoxicity possibly by triggering similar apoptosis pathway.
19363267 2009 Earlier onset of Alzheimer's disease: risk polymorphisms within PRNP, PRND, CYP46, and APOE genes.
19129949 2009 Doppel-induced cytotoxicity in human neuronal SH-SY5Y cells is antagonized by the prion protein.
18936526 2008 The doppel (Dpl) protein influences in vitro migration capability in astrocytoma-derived cells.
17894227 2007 [Expression of recombinant human doppel protein and analysis of its cytotoxic activities].
17390034 2007 Diagnostic value of PRND gene expression profiles in astrocytomas: relationship to tumor grades of malignancy.
More...