Property Summary

NCBI Gene PubMed Count 22
Grant Count 8
R01 Count 4
Funding $758,066.33
PubMed Score 16.51
PubTator Score 14.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.100 0.042
psoriasis 1.500 0.001
osteosarcoma 2.653 0.000
atypical teratoid / rhabdoid tumor -1.400 0.001
Atopic dermatitis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.900 0.003
intraductal papillary-mucinous carcinoma... 1.400 0.027
lung cancer 1.100 0.003
spina bifida -1.280 0.031
ovarian cancer -1.700 0.000

 GO Function (1)

Gene RIF (5)

PMID Text
23007389 analysis of the Nup153-Nup50 protein interface and its role in nuclear import
22130666 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin alpha5.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20016008 Results suggest that Npap60L and Npap60S function differently in nuclear protein import.
18854154 Knockdown of nucleoporin 50kDa (NUP50) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRNVGFESDTGGAFKGFKGLVVPSGG      1 - 70
GRFSGFGSGAGGKPLEGLSNGNNITSAPPFASAKAAADPKVAFGSLAANGPTTLVDKVSNPKTNGDSQQP     71 - 140
SSSGLASSKACVGNAYHKQLAALNCSVRDWIVKHVNTNPLCDLTPIFKDYEKYLANIEQQHGNSGRNSES    141 - 210
ESNKVAAETQSPSLFGSTKLQQESTFLFHGNKTEDTPDKKMEVASEKKTDPSSLGATSASFNFGKKVDSS    211 - 280
VLGSLSSVPLTGFSFSPGNSSLFGKDTTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVT    281 - 350
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTG    351 - 420
KNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA                          421 - 468
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23007389 2012 The Nup153-Nup50 protein interface and its role in nuclear import.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22130666 2012 Nucleoporin Nup50 stabilizes closed conformation of armadillo repeat 10 in importin ?5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...