Property Summary

NCBI Gene PubMed Count 28
PubMed Score 11.59
PubTator Score 15.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 2.922 0.000
cystic fibrosis -1.720 0.000
non-small cell lung carcinoma 1.300 0.000
lung adenocarcinoma 1.500 0.000
invasive ductal carcinoma 1.369 0.003
ovarian cancer 2.200 0.000
psoriasis -1.100 0.000

Synonym

Accession Q9UKX5 J3KQM2 Q8WYI8 Q9UKQ1
Symbols HsT18964

Gene

Gene RIF (16)

PMID Text
26403263 FGF2 may be redirecting fibroblasts towards an anti-fibrotic phenotype during wound healing by overriding TGFb1 mediated ITGA11 expression.
24962729 glycated collagen in the cardiac interstitium triggers an autocrine TGF-beta2 signaling pathway that stimulates alpha11 integrin expression through Smad2/3 binding elements in the alpha11 integrin promoter
24520080 Myometrium and uterine fibroids express ITGA11.
22869616 Interactions between alpha11 integrins and the Smad-dependent TGF-beta2 signalling may contribute to the formation of pro-fibrotic myofibroblasts and the development of a fibrotic interstitium in diabetic cardiomyopathy.
21796158 The disturbance of alpha11beta1 mediated interactions to collagen I results in a tremendous reduction of hMSC numbers owing to mitochondrial leakage accompanied by Bcl-2-associated X protein upregulation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913614 Data show that the 3 kb alpha11 promoter contains most of the regulatory elements that direct ectomesenchymal and mesodermal fibroblast-specific expression.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19641149 is a major collagen receptor on human periodontal ligament cells [and plays] a role in collagen lattice remodeling [ITGA11B1]
19390575 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGNKWLVVGAPLETNGYQKT      1 - 70
GDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCS     71 - 140
RVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVVQYGEDV    141 - 210
VHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDL    211 - 280
EKVIQQSERDNVTRYAVAVLGYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIF    281 - 350
SLEGTNKNETSFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN    351 - 420
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQAMRGQQIGSYFGSEITSVDID    421 - 490
GDGVTDVLLVGAPMYFNEGRERGKVYVYELRQNLFVYNGTLKDSHSYQNARFGSSIASVRDLNQDSYNDV    491 - 560
VVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATGLQYFGCSIHGQLDLNEDGLIDLAVGALGNA    561 - 630
VILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHFQTTTVGIRYNATMDER    631 - 700
RYTPRAHLDEGGDRFTNRAVLLSSGQELCERINFHVLDTADYVKPVTFSVEYSLEDPDHGPMLDDGWPTT    701 - 770
LRVSVPFWNGCNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAV    771 - 840
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVCNVSYPFFRAKAKVAFRL    841 - 910
DFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFTRSSSLSHYEVKPNSSLERYD    911 - 980
GIGPPFSCIFRIQNLGLFPIHGMMMKITIPIATRSGNRLLKLRDFLTDEANTSCNIWGNSTEYRPTPVEE    981 - 1050
DLRRAPQLNHSNSDVVSINCNIRLVPNQEINFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFR   1051 - 1120
EEDPSRQIVFEISKQEDWQVPIWIIVGSTLGGLLLLALLVLALWKLGFFRSARRRREPGLDPTPKVLE     1121 - 1188
//

Text Mined References (31)

PMID Year Title
26403263 2016 FGF2 Overrides TGF?1-Driven Integrin ITGA11 Expression in Human Dermal Fibroblasts.
24962729 2015 Glycated Collagen Induces ?11 Integrin Expression Through TGF-?2 and Smad3.
24823363 2014 Citrullination of collagen II affects integrin-mediated cell adhesion in a receptor-specific manner.
24520080 2014 Collagen-binding ?11 integrin expression in human myometrium and fibroids utilizing a novel RNA in situ probe.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
22869616 2012 ?11 integrin stimulates myofibroblast differentiation in diabetic cardiomyopathy.
21796158 2011 Integrins ?2?1 and ?11?1 regulate the survival of mesenchymal stem cells on collagen I.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...