Property Summary

NCBI Gene PubMed Count 25
Grant Count 48
R01 Count 38
Funding $3,841,349.31
PubMed Score 54.64
PubTator Score 34.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma -1.621 0.000
lung cancer -2.500 0.000
interstitial cystitis -4.100 0.000
invasive ductal carcinoma -2.075 0.018
Breast cancer -3.900 0.000
breast carcinoma -1.600 0.000
spina bifida -2.405 0.040

Gene RIF (12)

PMID Text
26738740 Alternative promoter use, conferring differential regulatory responses, is the main mechanism governing ELF5 action rather than differential transcriptional activity of the isoforms.
26717410 Data (including data from studies in transgenic mice) suggest that expression of ELF5 in luminal breast cancer correlates with increased myeloid cell invasion, inflammation, and lung metastasis.
25728398 Elf5 expression is inversely correlated with epithelial-mesenchymal transition in prostate cancer.
25629735 we identified Elf5 as a novel biomarker of urothelial cancer on several biological levels and established a causative link between Elf5 and epithelial-mesenchymal transition in urothelial cancer.
23300383 ELF5 provides a key transcriptional determinant of breast cancer molecular subtype by suppression of estrogen sensitivity in luminal breast cancer cells.
23086238 Elf5 inhibits the epithelial-mesenchymal transition in mammary gland development and breast cancer metastasis by transcriptionally repressing Snail2.
21787113 Loss of ELF5 is associated with kidney cancer.
20354077 ELF5 is expressed in the human placenta in villous cytotrophoblast cells but not in post-mitotic syncytiotrophoblast and invasive extravillous cytotrophoblast cells.
16704374 Identification of the ESE-2 consensus site and characterization of the transcriptional activation properties of ESE-2 shed new light on its potential as a regulator of target genes.
16229011 Our studies have identified a critical stretch of nucleotides that is important for both basal as well as calcium responsive reporter activity and that binds to a nuclear factor, keratinocyte restricted factor (KRF).
More...

AA Sequence

MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVW      1 - 70
EWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESK     71 - 140
ATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEA    141 - 210
LAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL                   211 - 265
//

Publication (25)

PMID Year Title
26738740 2016 ELF5 isoform expression is tissue-specific and significantly altered in cancer.
26717410 2015 ELF5 Drives Lung Metastasis in Luminal Breast Cancer through Recruitment of Gr1+ CD11b+ Myeloid-Derived Suppressor Cells.
25728398 2015 Elf5 inhibits TGF-?-driven epithelial-mesenchymal transition in prostate cancer by repressing SMAD3 activation.
25629735 2015 Epigenetic regulation of Elf5 is associated with epithelial-mesenchymal transition in urothelial cancer.
23300383 2012 ELF5 suppresses estrogen sensitivity and underpins the acquisition of antiestrogen resistance in luminal breast cancer.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
23086238 2012 Elf5 inhibits the epithelial-mesenchymal transition in mammary gland development and breast cancer metastasis by transcriptionally repressing Snail2.
21787113 2011 The Ets transcription factor ELF5 functions as a tumor suppressor in the kidney.
20354077 2010 ELF5-enforced transcriptional networks define an epigenetically regulated trophoblast stem cell compartment in the human placenta.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
More...