Property Summary

NCBI Gene PubMed Count 30
PubMed Score 58.02
PubTator Score 34.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.000 8.5e-10
breast carcinoma -1.600 3.5e-08
interstitial cystitis -2.200 3.3e-04
invasive ductal carcinoma -1.707 3.3e-02
lung cancer -2.100 6.9e-04
osteosarcoma -1.621 2.1e-07
psoriasis -2.400 1.9e-04
spina bifida -1.007 4.7e-02

Gene RIF (17)

AA Sequence

MPSLPHSHRVMLDSVTHSTFLPNASFCDPLMSWTDLFSNEEYYPAFEHQTACDSYWTSVHPEYWTKRHVW      1 - 70
EWLQFCCDQYKLDTNCISFCNFNISGLQLCSMTQEEFVEAAGLCGEYLYFILQNIRTQGYSFFNDAEESK     71 - 140
ATIKDYADSNCLKTSGIKSQDCHSHSRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEA    141 - 210
LAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQEDKL                   211 - 265
//

Text Mined References (30)

PMID Year Title