Property Summary

NCBI Gene PubMed Count 63
PubMed Score 69.01
PubTator Score 59.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 7.73284907470787E-15
breast carcinoma 1614 1.73536744591212E-12
intraductal papillary-mucinous adenoma (IPMA) 2956 2.83883804379611E-6
ulcerative colitis 2087 4.26341793150312E-6
malignant mesothelioma 3163 1.21327731454793E-5
interstitial cystitis 2299 1.26700652685591E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.59449761724752E-4
medulloblastoma 1524 4.80704866551173E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.63728276559663E-4
ductal carcinoma in situ 1745 0.001590193413144
colon cancer 1475 0.00287259520869437
invasive ductal carcinoma 2950 0.0030945973335637
astrocytic glioma 2241 0.00395052107398448
oligodendroglioma 2849 0.00444729594456906
ependymoma 2514 0.00718424159772802
pancreatic cancer 2300 0.0074435000761866
ovarian cancer 8492 0.0166379804355741
Waldenstrons macroglobulinemia 765 0.0177121240794706
cystic fibrosis and chronic rhinosinusitis 213 0.0385617016819193
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Hypothyroidism 89 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.255 1.6

Expression

Gene

PDB

2D86  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA EggNOG

Gene RIF (41)

PMID Text
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
25964534 discrete and different functions of VAV3.1 in metastasis and tumorigenesis are conceivable.
25791293 VAV3 overexpression could be a useful marker for predicting the outcomes of CRC patients and that VAV3 targeting represents a potential modality for treating CRC
25715123 VAV3 overexpression is a novel biomarker for poor prognosis and survival in ovarian carcinoma.
25430880 Inhibition of Vav3 could reverse the drug resistance of gastric cancer cells by downregulating JNK signaling pathway.
25305756 A new genome-wide significant association between VAV3 and IgA nephropathy.
24886537 This study proposes VAV3 as a biomarker and a rationale for its use as a signaling target to prevent and/or overcome resistance to endocrine therapy in breast cancer.
24072493 Vav3 is involved in the proliferation, migration, and invasion of gastric cancer cell as a tumor oncogene
23566222 Interrupting Vav3 signaling enhances docetaxel-induced apoptosis in LNCaP cells under chronic hypoxia by inhibiting the PI3K/Akt, ERK, and AR signaling pathways.
23403204 Data indicate that Vav3 oncogene protein plays a crucial role in prostate cancer growth and malignant behavior, and could be a potential therapeutic target.
More...

AA Sequence

MEPWKQCAQWLIHCKVLPTNHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFL      1 - 70
CLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESINDEDI     71 - 140
YKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTET    141 - 210
LESIEKYFMAPLKRFLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQ    211 - 280
YCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPTE    281 - 350
KANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER    351 - 420
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLK    421 - 490
KKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD    491 - 560
NCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG    561 - 630
DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT    631 - 700
KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE    701 - 770
HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS    771 - 840
TYVEEDE                                                                   841 - 847
//

Text Mined References (67)

PMID Year Title
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
25964534 2015 Differential Gene Expression of the Proto-oncogene VAV3 and the Transcript Variant VAV3.1 in Oral Squamous Cell Carcinoma.
25791293 2015 VAV3 oncogene expression in colorectal cancer: clinical aspects and functional characterization.
25715123 2015 VAV3 Overexpressed in Cancer Stem Cells Is a Poor Prognostic Indicator in Ovarian Cancer Patients.
25430880 2014 Inhibition of Vav3 could reverse the drug resistance of gastric cancer cells by downregulating JNK signaling pathway.
25305756 2014 Discovery of new risk loci for IgA nephropathy implicates genes involved in immunity against intestinal pathogens.
24886537 2014 VAV3 mediates resistance to breast cancer endocrine therapy.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722205 2014 A genome-wide association study on thyroid function and anti-thyroid peroxidase antibodies in Koreans.
24388013 2014 Genome-wide association analysis identifies 11 risk variants associated with the asthma with hay fever phenotype.
More...