Property Summary

NCBI Gene PubMed Count 200
Grant Count 169
R01 Count 94
Funding $17,805,815.55
PubMed Score 808.27
PubTator Score 1520.83

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKV8 Q8TCZ5 Q8WV58 Q96ID1 Argonaute2
Symbols Q10
EIF2C2

Gene

PDB

3LUC   3LUD   3LUG   3LUH   3LUJ   3LUK   3QX8   3QX9   4F3T   4OLA   4OLB   4W5N   4W5O   4W5Q   4W5R   4W5T   4Z4C   4Z4D   4Z4E   4Z4F   4Z4G   4Z4H   4Z4I   5JS1   5JS2   5KI6  

Gene RIF (156)

PMID Text
26809675 DIS3L2 interacts with Ago2 and governs target RNA-directed miRNA degradation.
26699195 the subcellular distribution of Ago2 occurs in a cell type- and tissue context-dependent manner and may correlate with its various functions in regulation of gene expression
26592935 Authors found that target binding of core-RISC starts at the seed region of the guide RNA. After target binding, four distinct reactions followed: target cleavage, transient binding, stable binding, and Argonaute 2 unloading.
26545861 genetic polymorphism in AGO2 may be a risk factor for the advanced lymph node metastasis of NPC in Chinese populations, and AGO2 acts as an oncogene in the development of NPC.
26518874 GRSF1 participated in the regulation of AGO2 by miR-346, and the middle sequence of miR-346 was vital for the synergy effect of miR-346 and GRSF1.
26507454 MiR-138 suppresses hTERT expression in an AGO2-dependent manner.
26475020 AGO2 suppression by miR-132 affects the steady state levels of miR-221 and miR-146a, two miRNAs involved in angiogenesis and inflammation, respectively.
26451954 HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication
26443379 Targeting of Ago2 to P-bodies and stress granules is separable from its role in RNAi and likely requires dynamic phosphorylation of serine 798.
26359634 Human Argonaute2 (Ago2) possesses a solvated surface pocket that specifically binds adenine nucleobases in the 1 position (t1) of target RNAs.
More...

AA Sequence

MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRV      1 - 70
NREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSL     71 - 140
QALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSL    141 - 210
WKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYR    211 - 280
VCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ    281 - 350
RCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY    351 - 420
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPC    421 - 490
FCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL    491 - 560
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR    561 - 630
VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQP    631 - 700
GITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD    701 - 770
DNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ    771 - 840
ALAKAVQVHQDTLRTMYFA                                                       841 - 859
//

Text Mined References (213)

PMID Year Title
27157137 2016 Post-transcriptional gene silencing activity of human GIGYF2.
26809675 2016 Identification of factors involved in target RNA-directed microRNA degradation.
26699195 2016 Cell Type- and Tissue Context-dependent Nuclear Distribution of Human Ago2.
26592935 2015 Single-molecule fluorescence measurements reveal the reaction mechanisms of the core RISC, composed of human Argonaute 2 and a guide RNA.
26545861 2015 Argonaute 2 and nasopharyngeal carcinoma: a genetic association study and functional analysis.
26518874 2015 miR-346 Up-regulates Argonaute 2 (AGO2) Protein Expression to Augment the Activity of Other MicroRNAs (miRNAs) and Contributes to Cervical Cancer Cell Malignancy.
26507454 2015 miR-346 and miR-138 competitively regulate hTERT in GRSF1- and AGO2-dependent manners, respectively.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26475020 2015 Suppression of AGO2 by miR-132 as a determinant of miRNA-mediated silencing in human primary endothelial cells.
26451954 2015 HuR and Ago2 Bind the Internal Ribosome Entry Site of Enterovirus 71 and Promote Virus Translation and Replication.
More...