Property Summary

NCBI Gene PubMed Count 230
PubMed Score 867.11
PubTator Score 1520.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (24)

Disease log2 FC p
malignant mesothelioma 1.400 2.0e-06
acute quadriplegic myopathy 1.252 2.0e-03
astrocytic glioma 1.500 1.4e-02
atypical teratoid / rhabdoid tumor 1.700 2.7e-08
Breast cancer 1.300 2.6e-05
diabetes mellitus -1.100 6.4e-03
ependymoma 1.300 3.1e-02
glioblastoma 1.100 3.2e-06
intraductal papillary-mucinous carcinoma... 1.200 5.4e-03
intraductal papillary-mucinous neoplasm ... 1.200 3.8e-02
lung cancer 2.100 3.0e-04
medulloblastoma 1.100 7.9e-04
medulloblastoma, large-cell 1.800 6.1e-05
non-small cell lung cancer 1.388 3.9e-10
oligodendroglioma 1.600 5.8e-03
osteosarcoma -1.493 7.8e-04
pancreatic ductal adenocarcinoma liver m... 1.684 1.3e-02
pediatric high grade glioma 1.300 3.5e-04
Pick disease 1.900 1.3e-04
primitive neuroectodermal tumor 1.400 8.8e-07
Rheumatoid arthritis 1.100 3.7e-03
spina bifida -1.424 2.0e-02
subependymal giant cell astrocytoma -1.178 3.0e-02
tuberculosis -1.400 2.8e-04

Protein-protein Interaction (6)

PDB (27)

Gene RIF (176)

AA Sequence

MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRV      1 - 70
NREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSL     71 - 140
QALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSL    141 - 210
WKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYR    211 - 280
VCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ    281 - 350
RCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY    351 - 420
GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPC    421 - 490
FCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL    491 - 560
SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR    561 - 630
VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQP    631 - 700
GITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGTSRPSHYHVLWD    701 - 770
DNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQ    771 - 840
ALAKAVQVHQDTLRTMYFA                                                       841 - 859
//

Text Mined References (243)

PMID Year Title