Property Summary

NCBI Gene PubMed Count 62
Grant Count 77
R01 Count 39
Funding $10,362,612.25
PubMed Score 283.82
PubTator Score 112.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 2.624 0.000
atypical teratoid / rhabdoid tumor -1.300 0.004
medulloblastoma -1.400 0.024
medulloblastoma, large-cell -2.500 0.002
Multiple Sclerosis 1.400 0.001
cystic fibrosis -1.300 0.000
severe Alzheimer's disease -1.187 0.040
spina bifida -1.136 0.029
Pick disease -1.100 0.046
pituitary cancer 1.600 0.035

Synonym

Accession Q9UKV5 P26442 Q8IZ70
Symbols GP78
RNF45

Gene

PDB

2EJS   2LVN   2LVO   2LVP   2LVQ   2LXH   2LXP   3FSH   3H8K   3TIW   4G3O   4LAD  

Gene RIF (43)

PMID Text
26424800 Authors conclude that the Hrd1 complex forms an essential retrotranslocation module that is evolutionarily conserved, but the mammalian ERAD system uses additional ubiquitin ligases to assist Hrd1 during retrotranslocation.
26136223 Downregulation of AMFR induced cell cycle arrest at the G0/G1 phase, and increased apoptosis of the THP1 cells.
25409783 gp78 elongates polyubiquitin chains from the distal end through the cooperation of its G2BR and CUE domains.
25149074 Data show that autocrine motility factor receptor (AMFR) and NOTCH1 protein are the direct target genes of microRNA miR-139-5p in colorectal cancer (CRC).
24820123 DGAT2 is regulated by gp78-associated endoplasmic-reticulum-associated degradation at the post-translational level.
24810856 Our data uncovers a previously unknown functional link between gp78 and TRIM25 and provides mechanistic insight into gp78-mediated protein ubiquitylation.
24714645 The ubiquitin ligase gp78, known for its role in protein quality control, is critical for unglycosylated PrP ubiquitylation and degradation.
24568530 High AMFR expression is associated with invasion depth and lymph node metastasis in gastric cancer.
24424410 The authors identify USP13 as a gp78-associated deubiquitinase that eliminates ubiquitin conjugates from Ubl4A to maintain the functionality of Bag6.
24285545 data thus implicate two parallel pathways by which Gp78 regulates MAVS signaling
More...

AA Sequence

MPLLFLERFPWPSLRTYTGLSGLALLGTIISAYRALSQPEAGPGEPDQLTASLQPEPPAPARPSAGGPRA      1 - 70
RDVAQYLLSDSLFVWVLVNTACCVLMLVAKLIQCIVFGPLRVSERQHLKDKFWNFIFYKFIFIFGVLNVQ     71 - 140
TVEEVVMWCLWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGRVLSLLVAMLLSCCGLAAVCSITGYT    141 - 210
HGMHTLAFMAAESLLVTVRTAHVILRYVIHLWDLNHEGTWEGKGTYVYYTDFVMELTLLSLDLMHHIHML    211 - 280
LFGNIWLSMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQA    281 - 350
ARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENLVPVAAAEGRPRLNQHNH    351 - 420
FFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITT    421 - 490
DNILEGRIQVPFPTQRSDSIRPALNSPVERPSSDQEEGETSAQTERVPLDLSPRLEETLDFGEVEVEPSE    491 - 560
VEDFEARGSRFSKSADERQRMLVQRKDELLQQARKRFLNKSSEDDAASESFLPSEGASSDPVTLRRRMLA    561 - 630
AAAERRLQKQQTS                                                             631 - 643
//

Text Mined References (67)

PMID Year Title
26424800 2015 gp78 functions downstream of Hrd1 to promote degradation of misfolded proteins of the endoplasmic reticulum.
26136223 2015 Autocrine motility factor receptor promotes the proliferation of human acute monocytic leukemia THP-1 cells.
25409783 2014 gp78 elongates of polyubiquitin chains from the distal end through the cooperation of its G2BR and CUE domains.
25149074 2014 MiR-139-5p inhibits migration and invasion of colorectal cancer by downregulating AMFR and NOTCH1.
24820123 2014 Regulation of diacylglycerol acyltransferase 2 protein stability by gp78-associated endoplasmic-reticulum-associated degradation.
24810856 2014 Polyubiquitylation of AMF requires cooperation between the gp78 and TRIM25 ubiquitin ligases.
24714645 2014 Ubiquitin ligase gp78 targets unglycosylated prion protein PrP for ubiquitylation and degradation.
24568530 2014 Aberrant expression of the autocrine motility factor receptor correlates with poor prognosis and promotes metastasis in gastric carcinoma.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24285545 2014 Regulation of mitochondrial antiviral signaling (MAVS) expression and signaling by the mitochondria-associated endoplasmic reticulum membrane (MAM) protein Gp78.
More...