Property Summary

NCBI Gene PubMed Count 86
PubMed Score 240.61
PubTator Score 558.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 4.64822148453844E-18
malignant mesothelioma 3163 1.13483237525821E-7
tuberculosis 1563 3.87126327172572E-6
lung cancer 4473 4.20347257553983E-6
cystic fibrosis 1670 4.71434510974362E-6
glioblastoma 5572 1.92679862806127E-4
atypical teratoid / rhabdoid tumor 4369 2.82508777698647E-4
osteosarcoma 7933 0.00425465597031702
medulloblastoma, large-cell 6234 0.00444712212494261
interstitial cystitis 2299 0.00551851896525397
oligodendroglioma 2849 0.0116655308815159
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0142928531761036
astrocytic glioma 2241 0.0180587519257862
medulloblastoma 1524 0.0198171577962279
ependymoma 2514 0.0243869068933426
primitive neuroectodermal tumor 3031 0.0361817010399119
pulmonary arterial hypertension 36 0.0389085565037074
adult high grade glioma 2148 0.0392633584991285
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
astrocytic glioma -1.600 0.018
ependymoma -1.700 0.024
oligodendroglioma -1.800 0.012
osteosarcoma 1.226 0.004
glioblastoma -2.400 0.000
cystic fibrosis 1.594 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.500 0.020
medulloblastoma, large-cell -2.600 0.004
primitive neuroectodermal tumor -1.800 0.036
tuberculosis 1.800 0.000
intraductal papillary-mucinous neoplasm ... 2.600 0.014
lung cancer 3.900 0.000
interstitial cystitis 1.100 0.006
adult high grade glioma -1.600 0.039
pulmonary arterial hypertension -1.400 0.039
lung carcinoma 1.600 0.000

Synonym

Accession Q9UKV0 A7E2F3 B7Z4I4 B7Z917 B7Z928 B7Z940 C9JS87 E7EX34 F8W9E0 O94845 O95028 Q2M2R6 Q86SL1 Q86US3 HD9
Symbols HD7
HD9
HD7b
HDAC
HDRP
MITR
HDAC7
HDAC7B
HDAC9B
HDAC9FL

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651909 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC9

Gene RIF (50)

PMID Text
27033599 HDAC9 was commonly expressed in retinoblastoma tissues and HDAC9 was overexpressed in prognostically poor retinoblastoma patients.
26420860 Data suggest, in chronic hepatitis C virus infection, HDAC9 (histone deacetylase 9) induction in liver regulates hepatic gluconeogenesis and systemic insulin resistance via deacetylation of FoxO1 (Forkhead box O 1) and HDAC3 (histone deacetylase 3).
26347468 Polymorphisms of HDAC9 is associated with Ischemic Stroke.
26093197 results indicate that HDAC9 variant rs2107595 may be not associated with IS risk in southern Han Chinese
26084607 the results of this study suggest that targeting HDACs by ST-3595 might represent as a novel and promising anti-pancreatic cancer strategy.
25760078 HDAC9 promotes tumor formation of glioblastoma via TAZ-mediated EGFR pathway activation.
25613642 Data show that miR-376a and HDAC9 expression are inversely correlated in hepatocellular carcinoma and suggest that HDAC9-mediated epigenetic modification may contribute to the down-regulation of the miR-376 cluster in hepatocellular carcinoma.
25388417 Gene expression studies in peripheral blood mononuclear cells revealed increased mRNA levels of HDAC9. Analysis of human atherosclerotic plaques revealed no association between rs2107595 and specific plaque characteristics.
24650256 The results elucidate the genetic etiology of lung adenocarcinoma by demonstrating that SNP rs10248565 in the HDAC9 gene may be a potential biomarker of cancer susceptibility.
24562770 The hydroxamic acid pan-HDAC inhibitor TSA synergistically inhibit the viability.
More...

AA Sequence

MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK      1 - 70
QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS     71 - 140
TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK    141 - 210
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN    211 - 280
GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK    281 - 350
QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP    351 - 420
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK    421 - 490
SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI    491 - 560
QEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGLEKHRLVSRTHSSPAASVLPHPAMDRPLQPG    561 - 630
SATGIAYDPLMLKHQCVCGNSTTHPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSL    631 - 700
LYGTNPLDGQKLDPRILLGDDSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGEL    701 - 770
KNGFAVVRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI    771 - 840
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAKEFDPDMVLVS    841 - 910
AGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTAICDASEACVNALLGNELEPL    911 - 980
AEDILHQSPNMNAVISLQKIIEIQSMSLKFS                                           981 - 1011
//

Text Mined References (88)

PMID Year Title
27033599 2016 Downregulation of HDAC9 inhibits cell proliferation and tumor formation by inducing cell cycle arrest in retinoblastoma.
26420860 2015 The Metabolic Regulator Histone Deacetylase 9 Contributes to Glucose Homeostasis Abnormality Induced by Hepatitis C Virus Infection.
26347468 2016 Association Between the Gene Polymorphisms of HDAC9 and the Risk of Atherosclerosis and Ischemic Stroke.
26093197 2015 Association of GWAS-supported loci rs2107595 in HDAC9 gene with ischemic stroke in southern Han Chinese.
26084607 2015 Targeting pancreatic cancer cells by a novel hydroxamate-based histone deacetylase (HDAC) inhibitor ST-3595.
25760078 2015 HDAC9 promotes glioblastoma growth via TAZ-mediated EGFR pathway activation.
25613642 2015 MiR-376a and histone deacetylation 9 form a regulatory circuitry in hepatocellular carcinoma.
25388417 2015 Deficiency of the stroke relevant HDAC9 gene attenuates atherosclerosis in accord with allele-specific effects at 7p21.1.
25256182 2014 Genome-wide association study of intracranial aneurysm identifies a new association on chromosome 7.
24650256 2014 SNP rs10248565 in HDAC9 as a novel genomic aberration biomarker of lung adenocarcinoma in non-smoking women.
More...