Property Summary

Ligand Count 93
NCBI Gene PubMed Count 102
PubMed Score 185.17
PubTator Score 558.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.600 3.9e-02
astrocytic glioma -1.600 1.8e-02
atypical teratoid / rhabdoid tumor -2.300 2.8e-04
cystic fibrosis 1.594 4.7e-06
ependymoma -1.700 2.4e-02
glioblastoma -1.200 1.2e-02
interstitial cystitis 1.100 5.5e-03
intraductal papillary-mucinous neoplasm ... 2.600 1.4e-02
lung cancer 3.900 4.2e-06
lung carcinoma 1.600 4.6e-18
malignant mesothelioma -1.700 1.1e-07
medulloblastoma -1.500 2.0e-02
medulloblastoma, large-cell -2.600 4.4e-03
oligodendroglioma -1.800 1.2e-02
osteosarcoma 1.226 4.3e-03
primitive neuroectodermal tumor -1.800 3.6e-02
pulmonary arterial hypertension -1.400 3.9e-02
tuberculosis 1.800 3.9e-06

Gene RIF (66)

AA Sequence

MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQK      1 - 70
QHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVAS     71 - 140
TEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK    141 - 210
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNN    211 - 280
GPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEK    281 - 350
QKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP    351 - 420
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSK    421 - 490
SIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQI    491 - 560
QEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGLEKHRLVSRTHSSPAASVLPHPAMDRPLQPG    561 - 630
SATGIAYDPLMLKHQCVCGNSTTHPEHAGRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSL    631 - 700
LYGTNPLDGQKLDPRILLGDDSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGEL    701 - 770
KNGFAVVRPPGHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI    771 - 840
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAKEFDPDMVLVS    841 - 910
AGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTAICDASEACVNALLGNELEPL    911 - 980
AEDILHQSPNMNAVISLQKIIEIQSMSLKFS                                           981 - 1011
//

Text Mined References (104)

PMID Year Title