Property Summary

NCBI Gene PubMed Count 13
PubMed Score 13.91
PubTator Score 8.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 1.368 8.7e-06
lung adenocarcinoma 1.784 1.9e-05
lung cancer 1.500 4.7e-03
ovarian cancer -1.400 1.9e-05
Pick disease -1.900 2.0e-06
psoriasis 1.700 2.6e-03

 GWAS Trait (1)

Gene RIF (4)

AA Sequence

MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQK      1 - 70
ELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEE     71 - 140
QRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGP    141 - 210
GPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINI    211 - 280
ASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVAL    281 - 350
CSMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE         351 - 415
//

Text Mined References (17)

PMID Year Title