Property Summary

NCBI Gene PubMed Count 12
PubMed Score 39.12
PubTator Score 35.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active Crohn's disease -1.283 1.6e-02
active ulcerative colitis -1.046 2.0e-02
adult high grade glioma -4.000 2.1e-04
astrocytic glioma -3.700 1.2e-03
Astrocytoma, Pilocytic -2.000 8.3e-03
atypical teratoid / rhabdoid tumor -4.900 1.4e-14
cystic fibrosis 3.180 1.7e-07
ductal carcinoma in situ -1.400 1.9e-03
ependymoma -4.000 1.4e-03
glioblastoma -3.700 1.8e-08
group 3 medulloblastoma -3.600 6.4e-03
intraductal papillary-mucinous adenoma (... -3.200 6.4e-03
intraductal papillary-mucinous carcinoma... -3.500 2.9e-03
intraductal papillary-mucinous neoplasm ... -3.900 5.4e-03
invasive ductal carcinoma -1.300 1.9e-02
lung adenocarcinoma -1.800 3.9e-16
lung cancer -2.500 2.2e-04
lung carcinoma -2.600 4.8e-19
malignant mesothelioma -5.100 1.8e-07
medulloblastoma, large-cell -4.600 2.8e-05
nephrosclerosis -1.422 2.8e-03
non-small cell lung cancer -1.365 7.0e-18
oligodendroglioma -3.300 4.0e-03
pancreatic cancer -2.200 2.1e-04
primitive neuroectodermal tumor -4.500 1.5e-06

Gene RIF (3)

AA Sequence

MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGA      1 - 70
SATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLR     71 - 140
LSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFL    141 - 210
YPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFD    211 - 280
EPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGV    281 - 350
VVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL    351 - 420
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLT    421 - 490
DVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYG    491 - 560
NAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKAL    561 - 630
KLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRL    631 - 700
LIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDR    701 - 770
MENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW    771 - 840
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLN    841 - 910
SEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKN    911 - 980
FMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH                              981 - 1024
//

Text Mined References (13)

PMID Year Title