Property Summary

NCBI Gene PubMed Count 12
PubMed Score 36.95
PubTator Score 35.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 1.18756175633701E-31
lung adenocarcinoma 2714 1.20700949620144E-25
lung carcinoma 2844 4.77236031012978E-19
atypical teratoid / rhabdoid tumor 4369 1.377366758662E-14
posterior fossa group A ependymoma 1511 2.80988431078217E-13
cystic fibrosis 1670 1.65568299825063E-7
malignant mesothelioma 3163 1.84153957573516E-7
primitive neuroectodermal tumor 3031 1.45172827824202E-6
ulcerative colitis 2087 4.50439728240395E-6
glioblastoma 5572 5.01217507181903E-6
lung cancer 4473 1.72865594110221E-5
medulloblastoma, large-cell 6234 2.78353117953934E-5
medulloblastoma 1524 8.2053132563755E-5
pancreatic cancer 2300 2.11033785338255E-4
adult high grade glioma 2148 2.12506969214003E-4
astrocytic glioma 2241 0.00119252358980339
ductal carcinoma in situ 1745 0.00190638242908079
nephrosclerosis 329 0.00276156901462894
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00293579932120223
oligodendroglioma 2849 0.00402556323556477
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0054448801270996
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00635810404992218
pilocytic astrocytoma 3086 0.00907795918789149
active Crohn's disease 918 0.0157680023079055
invasive ductal carcinoma 2950 0.0194417306452856
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Hypothyroidism 89 3.802 1.9

Expression

Synonym

Accession Q9UKU6 A5PL19 Q6UWJ4 TRH-DE
Symbols PAP-II
PGPEP2
TRH-DE

Gene

PANTHER Protein Class (3)

  Ortholog (10)

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGEDDAALRAGSRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSLVALLAVTMLAVLLSLRFDECGA      1 - 70
SATPGADGGPSGFPERGGNGSLPGSARRNHHAGGDSWQPEAGGVASPGTTSAQPPSEEEREPWEPWTQLR     71 - 140
LSGHLKPLHYNLMLTAFMENFTFSGEVNVEIACRNATRYVVLHASRVAVEKVQLAEDRAFGAVPVAGFFL    141 - 210
YPQTQVLVVVLNRTLDAQRNYNLKIIYNALIENELLGFFRSSYVLHGERRFLGVTQFSPTHARKAFPCFD    211 - 280
EPIYKATFKISIKHQATYLSLSNMPVETSVFEEDGWVTDHFSQTPLMSTYYLAWAICNFTYRETTTKSGV    281 - 350
VVRLYARPDAIRRGSGDYALHITKRLIEFYEDYFKVPYSLPKLDLLAVPKHPYAAMENWGLSIFVEQRIL    351 - 420
LDPSVSSISYLLDVTMVIVHEICHQWFGDLVTPVWWEDVWLKEGFAHYFEFVGTDYLYPGWNMEKQRFLT    421 - 490
DVLHEVMLLDGLASSHPVSQEVLQATDIDRVFDWIAYKKGAALIRMLANFMGHSVFQRGLQDYLTIHKYG    491 - 560
NAARNDLWNTLSEALKRNGKYVNIQEVMDQWTLQMGYPVITILGNTTAENRIIITQQHFIYDISAKTKAL    561 - 630
KLQNNSYLWQIPLTIVVGNRSHVSSEAIIWVSNKSEHHRITYLDKGSWLLGNINQTGYFRVNYDLRNWRL    631 - 700
LIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDR    701 - 770
MENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDW    771 - 840
ISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLN    841 - 910
SEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKN    911 - 980
FMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH                              981 - 1024
//

Text Mined References (13)

PMID Year Title
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21452313 2011 Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237162 2010 Chemerin, a novel adipokine in the regulation of angiogenesis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...