Property Summary

NCBI Gene PubMed Count 23
Grant Count 11
R01 Count 9
Funding $954,155.25
PubMed Score 72.32
PubTator Score 16.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
gastric cancer 1.300 0.013
astrocytoma -1.100 0.000
glioblastoma -3.800 0.000
osteosarcoma -5.684 0.000
ependymoma -1.900 0.000
sonic hedgehog group medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -5.100 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor -2.400 0.001
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -1.700 0.001
Alzheimer's disease -1.200 0.019
Pick disease -1.500 0.000
pituitary cancer 1.500 0.000

Protein-protein Interaction (2)

Gene RIF (16)

PMID Text
22205969 variations in the ACSL6 gene may contribute to the quantity of cigarettes smoked
20429931 The alternative fatty acid Gate-domain motifs are essential determinants for the activity of the human ACSL6 isoforms, which appear to act as homodimeric enzyme as well as in complex with other spliced forms.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of acyl-CoA synthetase long-chain family member 6 (ACSL6) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19064571 Observational study of gene-disease association. (HuGE Navigator)
18804346 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18718982 ACSL6 is highly associated with schizophrenia and several haplotypes in this haploblock have about twofold to 10-fold increase in the affected subjects in Han Chinese.
18718982 Observational study of gene-disease association. (HuGE Navigator)
18555221 The acyl-coenzyme A synthetase long-chain family member 6 (ACSL6) gene on chromosome 5q31 was associated with premature ovarian failure and identified disease-susceptibility haplotypes.
18555221 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGA      1 - 70
RRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQH     71 - 140
NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLL    141 - 210
EHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTT    211 - 280
GNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRL    281 - 350
LSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI    351 - 420
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIK    421 - 490
LVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIF    491 - 560
KLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDL    561 - 630
KKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM       631 - 697
//

Publication (25)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22205969 2011 ACSL6 is associated with the number of cigarettes smoked and its expression is altered by chronic nicotine exposure.
20429931 2010 Activity of the acyl-CoA synthetase ACSL6 isoforms: role of the fatty acid Gate-domains.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18804346 2008 Interaction between interleukin 3 and dystrobrevin-binding protein 1 in schizophrenia.
18718982 2008 Association of haplotypes spanning PDZ-GEF2, LOC728637 and ACSL6 with schizophrenia in Han Chinese.
18555221 2009 Acyl-CoA synthetase long-chain family member 6 is associated with premature ovarian failure.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
More...