Property Summary

NCBI Gene PubMed Count 24
PubMed Score 73.81
PubTator Score 16.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 5.9e-04
Alzheimer's disease -1.200 1.9e-02
astrocytoma -1.100 3.7e-05
Astrocytoma, Pilocytic -1.200 3.4e-04
atypical teratoid / rhabdoid tumor -3.400 1.3e-13
ependymoma -1.100 8.9e-04
gastric cancer 1.300 1.3e-02
glioblastoma -1.900 3.0e-06
group 3 medulloblastoma -2.200 1.8e-05
medulloblastoma, large-cell -2.400 2.8e-05
osteosarcoma -5.684 3.0e-07
Pick disease -1.400 1.4e-04
pituitary cancer 1.300 5.5e-04
primitive neuroectodermal tumor -2.000 1.4e-05

Gene RIF (17)

AA Sequence

MQTQEILRILRLPELGDLGQFFRSLSATTLVSMGALAAILAYWFTHRPKALQPPCNLLMQSEEVEDSGGA      1 - 70
RRSVIGSGPQLLTHYYDDARTMYQVFRRGLSISGNGPCLGFRKPKQPYQWLSYQEVADRAEFLGSGLLQH     71 - 140
NCKACTDQFIGVFAQNRPEWIIVELACYTYSMVVVPLYDTLGPGAIRYIINTADISTVIVDKPQKAVLLL    141 - 210
EHVERKETPGLKLIILMDPFEEALKERGQKCGVVIKSMQAVEDCGQENHQAPVPPQPDDLSIVCFTSGTT    211 - 280
GNPKGAMLTHGNVVADFSGFLKVTEKVIFPRQDDVLISFLPLAHMFERVIQSVVYCHGGRVGFFQGDIRL    281 - 350
LSDDMKALCPTIFPVVPRLLNRMYDKIFSQANTPLKRWLLEFAAKRKQAEVRSGIIRNDSIWDELFFNKI    351 - 420
QASLGGCVRMIVTGAAPASPTVLGFLRAALGCQVYEGYGQTECTAGCTFTTPGDWTSGHVGAPLPCNHIK    421 - 490
LVDVEELNYWACKGEGEICVRGPNVFKGYLKDPDRTKEALDSDGWLHTGDIGKWLPAGTLKIIDRKKHIF    491 - 560
KLAQGEYVAPEKIENIYIRSQPVAQIYVHGDSLKAFLVGIVVPDPEVMPSWAQKRGIEGTYADLCTNKDL    561 - 630
KKAILEDMVRLGKESGLHSFEQVKAIHIHSDMFSVQNGLLTPTLKAKRPELREYFKKQIEELYSISM       631 - 697
//

Text Mined References (26)

PMID Year Title