Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
Funding $1,413,443
PubMed Score 87.16
PubTator Score 6.36

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.004
psoriasis -1.200 0.001
osteosarcoma -1.532 0.000
atypical teratoid / rhabdoid tumor -1.700 0.003
glioblastoma -1.100 0.016
medulloblastoma, large-cell -1.500 0.003
group 4 medulloblastoma 1.200 0.000
ovarian cancer -2.200 0.000
dermatomyositis 1.100 0.001

Gene RIF (3)

23651062 RACK1 competes with GCM1 for FBW2 and thereby prevents GCM1 ubiquitination, which is also supported by the observation that GCM1 is destabilized in RACK1-knockdown BeWo placental cells
18703417 UBE2D2 is required for GCMa ubiquitination and for association with the SCF(FBXW2) complex.
15640526 the SCF(hFBW2) E3 complex has a key role in targeting hGCMa to the ubiquitin-proteasome degradation system

AA Sequence

SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG                                        421 - 454

Text Mined References (21)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23651062 2013 RACK1 (receptor for activated C-kinase 1) interacts with FBW2 (F-box and WD-repeat domain-containing 2) to up-regulate GCM1 (glial cell missing 1) stability and placental cell migration and invasion.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18703417 2008 Ubiquitin-conjugating enzyme UBE2D2 is responsible for FBXW2 (F-box and WD repeat domain containing 2)-mediated human GCM1 (glial cell missing homolog 1) ubiquitination and degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15640526 2005 FBW2 targets GCMa to the ubiquitin-proteasome degradation system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).