Property Summary

NCBI Gene PubMed Count 20
PubMed Score 115.14
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 2.5e-03
dermatomyositis 1.100 8.3e-04
glioblastoma -1.100 1.6e-02
group 4 medulloblastoma 1.100 3.0e-03
medulloblastoma, large-cell -1.500 2.6e-03
osteosarcoma -1.022 2.4e-05
ovarian cancer -2.200 4.9e-07
psoriasis -1.200 1.4e-03
Rheumatoid arthritis 1.400 3.8e-03

Gene RIF (3)

AA Sequence

MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLK      1 - 70
WLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFE     71 - 140
TSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVAC    141 - 210
WEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCK    211 - 280
VKSLLHSPGDYILLSADKYEIKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQW    281 - 350
DFASYDILRVIKTPEIANLALLGFGDIFALLFDNRYLYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEA    351 - 420
SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG                                        421 - 454
//

Text Mined References (23)

PMID Year Title