Property Summary

NCBI Gene PubMed Count 14
Grant Count 9
R01 Count 9
Funding $398,462.23
PubMed Score 9.59
PubTator Score 7.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 0.019
ependymoma -1.300 0.028
oligodendroglioma -1.200 0.014
osteosarcoma -1.726 0.000
glioblastoma -1.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.100 0.001
pancreatic ductal adenocarcinoma liver m... -1.230 0.020
spina bifida -1.192 0.015
ulcerative colitis -1.100 0.000
ovarian cancer -1.500 0.000

Gene RIF (5)

PMID Text
26243628 Data show that CRISPR/Cas9 genome editing generated F-box and leucine-rich repeat protein 3 (Fbxl3) knockout in circadian clock model U2OS cells.
24085301 Substrate binding promotes formation of the Skp1-Cul1-Fbxl3 (SCF(Fbxl3)) protein complex.
23616524 Mutation in the Fbxl3 protein reveals distinct roles for CRY1 and CRY2 in the circadian molecular clockwork.
23503662 crystal structures of mammalian CRY2 in its apo, FAD-bound and FBXL3-SKP1-complexed forms
17463251 study demonstrates that the SCF(Fbxl3)ubiquitin ligase controls the oscillations of the circadian clock by mediating the degradation of Cry1 and Cry2 proteins

AA Sequence

MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVF      1 - 70
HMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLK     71 - 140
TLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPH    141 - 210
VSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAF    211 - 280
IRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEE    281 - 350
LIRIAERCKNLSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW    351 - 420
FPDMMPTW                                                                  421 - 428
//

Text Mined References (17)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
26243628 2015 Highly Efficient Genome Editing via CRISPR/Cas9 to Create Clock Gene Knockout Cells.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24085301 2013 Substrate binding promotes formation of the Skp1-Cul1-Fbxl3 (SCF(Fbxl3)) protein complex.
23616524 2013 Distinct and separable roles for endogenous CRY1 and CRY2 within the circadian molecular clockwork of the suprachiasmatic nucleus, as revealed by the Fbxl3(Afh) mutation.
23503662 2013 SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket.
23452855 2013 Competing E3 ubiquitin ligases govern circadian periodicity by degradation of CRY in nucleus and cytoplasm.
17463251 2007 SCFFbxl3 controls the oscillation of the circadian clock by directing the degradation of cryptochrome proteins.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...