Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.16
PubTator Score 7.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.100 1.9e-02
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
ependymoma -1.300 2.8e-02
glioblastoma -1.100 1.4e-06
medulloblastoma, large-cell -1.700 2.1e-04
oligodendroglioma -1.200 1.4e-02
osteosarcoma -1.726 1.1e-05
ovarian cancer -1.500 5.1e-07
pancreatic ductal adenocarcinoma liver m... -1.230 2.0e-02
primitive neuroectodermal tumor -1.100 1.0e-03
spina bifida -1.192 1.5e-02
ulcerative colitis -1.100 1.5e-04

 IMPC Phenotype (1)

Protein-protein Interaction (4)

Gene RIF (7)

AA Sequence

MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVF      1 - 70
HMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQLVNCSLK     71 - 140
TLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPH    141 - 210
VSPAGILCVADQCHGLRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAF    211 - 280
IRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEE    281 - 350
LIRIAERCKNLSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW    351 - 420
FPDMMPTW                                                                  421 - 428
//

Text Mined References (20)

PMID Year Title