Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
18404645 Using both family and case-control samples, consistent associations in and around FBXL21 gene suggested that FBXL21 may be associated with schizophrenia in the Irish samples.
18404645 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKRNSLSVENKIVQLSGAAKQPKVGFYSSLNQTHTHTVLLDWGSLPHHVVLQIFQYLPLLDRACASSVCR      1 - 70
RWNEVFHISDLWRKFEFELNQSATSSFKSTHPDLIQQIIKKHFAHLQYVSFKVDSSAESAEAACDILSQL     71 - 140
VNCSIQTLGLISTAKPSFMNVSESHFVSALTVVFINSKSLSSIKIEDTPVDDPSLKILVANNSDTLRLPK    141 - 210
MSSCPHVSSDGILCVADRCQGLRELALNYYILTDELFLALSSETHVNLEHLRIDVVSENPGQIKFHAVKK    211 - 280
HSWDALIKHSPRVNVVMHFFLYEEEFETFFKEETPVTHLYFGRSVSKVVLGRVGLNCPRLIELVVCANDL    281 - 350
QPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSK    351 - 420
YLGRVWFPDVMPLW                                                            421 - 434
//

Publication (8)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18404645 2008 FBXL21 association with schizophrenia in Irish family and case-control samples.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10531035 1999 Identification of a family of human F-box proteins.