Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 3.08

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MKRNSLSVENKIVQLSGAAKQPKVGFYSSLNQTHTHTVLLDWGSLPHHVVLQIFQYLPLLDRACASSVCR      1 - 70
RWNEVFHISDLWRKFEFELNQSATSSFKSTHPDLIQQIIKKHFAHLQYVSFKVDSSAESAEAACDILSQL     71 - 140
VNCSIQTLGLISTAKPSFMNVSESHFVSALTVVFINSKSLSSIKIEDTPVDDPSLKILVANNSDTLRLPK    141 - 210
MSSCPHVSSDGILCVADRCQGLRELALNYYILTDELFLALSSETHVNLEHLRIDVVSENPGQIKFHAVKK    211 - 280
HSWDALIKHSPRVNVVMHFFLYEEEFETFFKEETPVTHLYFGRSVSKVVLGRVGLNCPRLIELVVCANDL    281 - 350
QPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSK    351 - 420
YLGRVWFPDVMPLW                                                            421 - 434
//

Text Mined References (9)

PMID Year Title