Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.95
PubTator Score 10.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma 5572 1.11662419683784E-5
posterior fossa group B ependymoma 1530 1.93993632918765E-5
ovarian cancer 8492 1.08936100720732E-4
group 3 medulloblastoma 2254 0.00187864602190403
acute myeloid leukemia 785 0.0466041439683689

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000
glioblastoma 1.200 0.000
group 3 medulloblastoma 1.100 0.002
acute myeloid leukemia -2.000 0.047
ovarian cancer 1.300 0.000

Synonym

Accession Q9UKT5 Q68CU8 Q86VT8 Q9UK98
Symbols FBX4

Gene

PDB

3L2O   3L82  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (8)

PMID Text
24704453 results define the impact of alternative splicing on Fbx4 function, and suggest that the attenuated cyclin D1 degradation by these novel Fbx4 isoforms provides a new insight for aberrant cyclin D1 expression in human cancers.
24019069 The FBXO4 I377M mutant exhibits impaired cyclin D1 recruitment and ubiquitylation.
21242966 14-3-3varepsilon binds to Ser12-phosphorylated Fbx4 to mediate dimerization and function.
20181953 Biochemical studies indicate that both the N-terminal domain and a loop connecting the linker and C-terminal domain of Fbx4 are critical for the dimerization and activation of the protein.
20159592 results reveal an atypical small GTPase domain within Fbx4 as a substrate-binding motif for SCF(Fbx4) and uncover a mechanism for selective ubiquitination and degradation of TRF1 in telomere homeostasis control
18598945 Mutations in Fbx4 inhibit dimerization of the SCF(Fbx4) ligase and contribute to cyclin D1 overexpression in human cancer.
17081987 SCF(FBX4-alphaB crystallin) is an E3 ubiquitin ligase that promotes ubiquitin-dependent degradation of Thr286-phosphorylated cyclin D1.
16275645 Fbx4 is a central regulator of Pin2/TRF1 protein abundance and alterations in the stability of Pin2/TRF1 can have a dramatic impact on telomere length

AA Sequence

MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYI      1 - 70
LSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYM     71 - 140
AVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLP    141 - 210
QRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQ    211 - 280
KVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHL    281 - 350
NLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAR                                     351 - 387
//

Text Mined References (29)

PMID Year Title
24704453 2014 Alternative splicing variants of human Fbx4 disturb cyclin D1 proteolysis in human cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019069 2013 The FBXO4 tumor suppressor functions as a barrier to BRAFV600E-dependent metastatic melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
21378169 2011 A Competitive binding mechanism between Skp1 and exportin 1 (CRM1) controls the localization of a subset of F-box proteins.
21242966 2011 Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3?.
20181953 2010 Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
20159592 2010 Structural basis of selective ubiquitination of TRF1 by SCFFbx4.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...