Property Summary

NCBI Gene PubMed Count 27
PubMed Score 11.14
PubTator Score 10.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 3.1e-06
glioblastoma 5792 1.1e-05
ovarian cancer 8520 1.1e-04
group 3 medulloblastoma 4104 1.9e-03
acute myeloid leukemia 783 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -2.000 4.7e-02
ependymoma 1.100 3.1e-06
glioblastoma 1.200 1.1e-05
group 3 medulloblastoma 1.100 1.9e-03
ovarian cancer 1.300 1.1e-04

Protein-protein Interaction (7)

Gene RIF (8)

AA Sequence

MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYI      1 - 70
LSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYM     71 - 140
AVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLP    141 - 210
QRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQ    211 - 280
KVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHL    281 - 350
NLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAR                                     351 - 387
//

Text Mined References (31)

PMID Year Title