Property Summary

NCBI Gene PubMed Count 42
PubMed Score 55.98
PubTator Score 43.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.145 2.0e-02
adult high grade glioma 1.700 7.0e-04
astrocytoma 1.100 3.0e-10
Atopic dermatitis 1.200 3.9e-04
atypical teratoid / rhabdoid tumor 1.600 4.3e-05
Breast cancer 2.400 3.0e-02
colon cancer 1.600 9.7e-03
ductal carcinoma in situ 1.100 2.2e-02
Endometriosis 1.105 4.4e-02
glioblastoma 1.800 6.2e-08
group 3 medulloblastoma 2.400 1.6e-04
invasive ductal carcinoma 1.200 1.1e-02
lung cancer 1.700 4.1e-03
malignant mesothelioma 2.000 3.8e-07
medulloblastoma, large-cell 2.200 2.6e-05
nasopharyngeal carcinoma 1.300 5.3e-05
non-small cell lung cancer 1.038 1.5e-14
oligodendroglioma 1.400 2.0e-08
ovarian cancer 1.200 1.1e-02
primary Sjogren syndrome 1.100 1.3e-02
primitive neuroectodermal tumor 1.900 1.1e-04

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGR      1 - 70
LVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSR     71 - 140
LYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAK    141 - 210
RNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTT    211 - 280
WKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGD    281 - 350
QKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS    351 - 420
DGKLLKASCKIGPLPGTKKSKKNLRRL                                               421 - 447
//

Text Mined References (44)

PMID Year Title