Property Summary

NCBI Gene PubMed Count 41
PubMed Score 55.41
PubTator Score 43.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.29192766063254E-16
astrocytoma 1493 2.96443221658688E-10
oligodendroglioma 2849 2.03495501122671E-8
glioblastoma 5572 6.17426466238117E-8
sonic hedgehog group medulloblastoma 1482 8.26198873623687E-8
atypical teratoid / rhabdoid tumor 4369 1.75188634447781E-7
malignant mesothelioma 3163 3.82069930936294E-7
pediatric high grade glioma 2712 9.54585224448144E-7
medulloblastoma, large-cell 6234 2.58752667506151E-5
nasopharyngeal carcinoma 1056 5.29022332340259E-5
primitive neuroectodermal tumor 3031 6.6818707679403E-5
Atopic dermatitis 944 3.92022217176692E-4
lung cancer 4473 0.00408439744931734
colon cancer 1475 0.00968567859919655
ovarian cancer 8492 0.0105562920636784
invasive ductal carcinoma 2950 0.0105711190020397
primary Sjogren syndrome 789 0.0134619581724829
adrenocortical carcinoma 1427 0.0196164174697159
ductal carcinoma in situ 1745 0.0220954006691942
Breast cancer 3099 0.0302980601959589
Endometriosis 535 0.0438077809007131

Expression

  Differential Expression (21)

Synonym

Accession Q9UKT4 B3KNX5 Q5TF47 Q8WV29 Q9UGC8
Symbols EMI1
FBX5
Fbxo31

Gene

PDB

2M6N   4UI9  

  Ortholog (13)

Gene RIF (21)

PMID Text
24277465 Examined eoffect of Emi1 over-expression on Skp2 expression in breast cancer. Found expression of Emi1 was positively related with Skp2 expression; Emi1 expression correlated significantly with histologic grade. Skp2 expression obtained similar results.
24074588 Human papillomavirus type 16 E7 expression causes increased EMI1 mRNA expression and also inhibits EMI1 degradation.
23708605 The C-terminal domain inhibits multiple APC/C(CDH1) functions. The intrinsically disordered D-box, linker & tail elements, & a structured Zn-binding domain synergistically block the substrate-binding site & inhibit ubiquitin-chain elongation.
23645673 Emi1 depletion enhances the sensitivity of cancer cells to doxorubicin and x-ray irradiation.
23202783 Emi1 expression (>5%) was seen in 23.3% of ovarian clear cell carcinoma, and associated with high FIGO grades and poor overall survival
22995332 Emi1 participates in human hepatocellular carcinoma (HCC) cell proliferation and that progression is controlled by anaphase-promoting complex/cyclosome (APC/C) inhibition, which stabilized Skp2 and enabled p27(kip1) degradation.
21454540 the ability of Emi1 to inhibit APC/C is negatively regulated by CDKs
20800603 Observational study of gene-disease association. (HuGE Navigator)
20717963 Results suggest that Bcr-Abl increases Emi1 phosphorylation and stability to prevent Skp2 protein degradation via APC/Cdh1-induced ubiquitination and to enhance proliferation of CML cells.
20641033 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGR      1 - 70
LVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSR     71 - 140
LYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAK    141 - 210
RNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTT    211 - 280
WKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGD    281 - 350
QKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS    351 - 420
DGKLLKASCKIGPLPGTKKSKKNLRRL                                               421 - 447
//

Text Mined References (43)

PMID Year Title
24277465 2013 The expression and prognosis of Emi1 and Skp2 in breast carcinoma: associated with PI3K/Akt pathway and cell proliferation.
24074588 2013 Human papillomavirus type 16 E7 oncoprotein inhibits the anaphase promoting complex/cyclosome activity by dysregulating EMI1 expression in mitosis.
23708605 2013 Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.
23645673 2013 Selective enhancing effect of early mitotic inhibitor 1 (Emi1) depletion on the sensitivity of doxorubicin or X-ray treatment in human cancer cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23202783 2013 Clear cell carcinomas of the ovary: a multi-institutional study of 129 cases in Korea with prognostic significance of Emi1 and Galectin-3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22995332 2013 Early mitotic inhibitor-1, an anaphase-promoting complex/cyclosome inhibitor, can control tumor cell proliferation in hepatocellular carcinoma: correlation with Skp2 stability and degradation of p27(Kip1).
21454540 2011 Regulation of the action of early mitotic inhibitor 1 on the anaphase-promoting complex/cyclosome by cyclin-dependent kinases.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
More...