Property Summary

NCBI Gene PubMed Count 37
PubMed Score 15.80
PubTator Score 92.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (25)

AA Sequence

METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEECDRKPLSREDE      1 - 70
IRGHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPF     71 - 140
HCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSS    141 - 210
LEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSST    211 - 280
PQKFVGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPV    281 - 350
ISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSY    351 - 420
QGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHM    421 - 490
GCHGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH                                      491 - 526
//

Text Mined References (41)

PMID Year Title