Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
Funding $730,898.19
PubMed Score 14.96
PubTator Score 92.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (23)

PMID Text
26495986 The results show that high vs. low expression of Nrp-1 or Helios does not unequivocally identify Treg clones of thymic or peripheral origin.
25586548 Helios could be considered a more reliable marker for distinguishing thymic derived Regulatory T (tTreg) cells or peripherally induced Treg cells than Nrp1.
25446972 The immunosuppressive enzyme IL4I1 expressed differentially in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25425428 Forkhead box protein 3(+) regulatory T cells and Helios(+) subset in perinatally acquired HIV.
25008482 expression is not affected in diGeorge syndrome
23600753 Ectopic expression of ATL-type Helios isoform as well as knockdown of normal Helios or Ikaros promoted T-cell growth.
23409157 large number of ex vivo expanded functional Treg can be obtained from long-term T1D patients, although fewer expanded Treg expressed a high level of Helios
23365462 A differential role for monocyte subsets in control of Helios(+/-) Treg development that is mediated by distinct inflammatory cytokines.
23359504 Helios+ and Helios- cells coexist within the natural FOXP3+ T regulatory cell subset in humans.
23264341 Foxp3+ Helios+ regulatory T cells are expanded in active systemic lupus erythematosus.
More...

AA Sequence

METEAIDGYITCDNELSPEREHSNMAIDLTSSTPNGQHASPSHMTSTNSVKLEMQSDEECDRKPLSREDE      1 - 70
IRGHDEGSSLEEPLIESSEVADNRKVQELQGEGGIRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPF     71 - 140
HCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSS    141 - 210
LEEHKERCHNYLQNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTGNMGKRKSST    211 - 280
PQKFVGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPV    281 - 350
ISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQEREASPSNSCLDSTDSESSHDDHQSY    351 - 420
QGHPALNPKRKQSPAYMKEDVKALDTTKAPKGSLKDIYKVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHM    421 - 490
GCHGYRDPLECNICGYRSQDRYEFSSHIVRGEHTFH                                      491 - 526
//

Publication (38)

PMID Year Title
26495986 2015 Differences in Expression Level of Helios and Neuropilin-1 Do Not Distinguish Thymus-Derived from Extrathymically-Induced CD4+Foxp3+ Regulatory T Cells.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25586548 2015 Concomitant analysis of Helios and Neuropilin-1 as a marker to detect thymic derived regulatory T cells in naïve mice.
25446972 2015 Differential expression of the immunosuppressive enzyme IL4I1 in human induced Aiolos+, but not natural Helios+, FOXP3+ Treg cells.
25425428 2015 Forkhead box protein 3(+) regulatory T cells and Helios(+) subset in perinatally acquired HIV.
25416956 2014 A proteome-scale map of the human interactome network.
25008482 2014 Helios expression in T-regulatory cells in patients with di George Syndrome.
23600753 2013 Adult T-cell leukemia cells are characterized by abnormalities of Helios expression that promote T cell growth.
23409157 2013 Foxp3+ Treg expanded from patients with established diabetes reduce Helios expression while retaining normal function compared to healthy individuals.
23365462 2013 Differential control of Helios(+/-) Treg development by monocyte subsets through disparate inflammatory cytokines.
More...