Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.14
PubTator Score 6.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
Atopic dermatitis 1.100 0.000
lung cancer 1.100 0.001
diabetes mellitus -1.100 0.005
group 4 medulloblastoma -1.200 0.001

Synonym

Accession Q9UKS6 A6NH84 Q9H331 Q9NWV9
Symbols SDPIII

Gene

Gene RIF (4)

PMID Text
24500282 Show that in neuroendocrine chromaffin cells fusion pore expansion and catecholamine release are limited specifically by mutation of syndapin 3.
22573331 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
18174177 PACSIN 3 acts as an auxiliary protein of TRPV4 channel that not only affects the channel's subcellular localization but also modulates its function in a stimulus-specific manner.
12952982 PACSIN3 has a novel function as an up-regulator in the signaling of proHB-EGF shedding induced by TPA and angiotensin II

AA Sequence

MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGTVEK      1 - 70
GPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQ     71 - 140
KPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTL    141 - 210
AELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEED    211 - 280
LRWWRSTHGPGMAMNWPQFEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQD    281 - 350
EEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE    351 - 420
CVGA                                                                      421 - 424
//

Publication (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24500282 2014 Syndapin 3 modulates fusion pore expansion in mouse neuroendocrine chromaffin cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23236520 2012 Versatile membrane deformation potential of activated pacsin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22573331 2012 Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...