Property Summary

NCBI Gene PubMed Count 25
PubMed Score 5.43
PubTator Score 6.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis 1.100 9.5e-05
diabetes mellitus -1.100 5.3e-03
group 4 medulloblastoma -1.200 9.5e-04
lung cancer 1.100 7.1e-04
malignant mesothelioma 1.300 2.0e-05

Gene RIF (4)

AA Sequence

MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGTVEK      1 - 70
GPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAFHRPVLGGFRESRAAEDGFRKAQ     71 - 140
KPWLKRLKEVEASKKSYHAARKDEKTAQTRESHAKADSAVSQEQLRKLQERVERCAKEAEKTKAQYEQTL    141 - 210
AELHRYTPRYMEDMEQAFETCQAAERQRLLFFKDMLLTLHQHLDLSSSEKFHELHRDLHQGIEAASDEED    211 - 280
LRWWRSTHGPGMAMNWPQFEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGTAPPPQSPGSPGTGQD    281 - 350
EEWSDEESPRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE    351 - 420
CVGA                                                                      421 - 424
//

Text Mined References (34)

PMID Year Title