Property Summary

NCBI Gene PubMed Count 3
PubMed Score 87.02
PubTator Score 41.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 9.9e-05
Disease Target Count Z-score Confidence
Retinitis pigmentosa 3 16 4.14 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.083 9.9e-05

AA Sequence

MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVL      1 - 70
LGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDY     71 - 140
STQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKI    141 - 210
TKTQSFTLSGSSLGAAVIQRWGSRYVAQAGLELLA                                       211 - 245
//

Text Mined References (5)

PMID Year Title