Property Summary

NCBI Gene PubMed Count 3
Grant Count 1
Funding $273,230
PubMed Score 73.38
PubTator Score 41.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Gonorrhea 14 3.081 1.5
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.083 0.000

AA Sequence

MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVL      1 - 70
LGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDY     71 - 140
STQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKI    141 - 210
TKTQSFTLSGSSLGAAVIQRWGSRYVAQAGLELLA                                       211 - 245
//

Text Mined References (5)

PMID Year Title
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10500248 1999 The molecular characterisation of a novel tetraspanin protein, TM4-B(1).