Property Summary

NCBI Gene PubMed Count 32
PubMed Score 18.63
PubTator Score 26.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -3.900 0.020
psoriasis 4.000 0.000
osteosarcoma 1.492 0.000
non-small cell lung cancer 1.261 0.000
adult high grade glioma 1.100 0.002
ovarian cancer 1.300 0.000

Synonym

Accession Q9UKR3 A7UNK6 Q86VI8 Q9Y433
Symbols KLKL4
KLK-L4

Gene

PANTHER Protein Class (3)

Gene RIF (18)

PMID Text
25677900 Our results suggest that KLK13 mRNA expression constitutes a novel biomarker for the prediction of overall survival in nonsmall cell lung cancer and that its quantitative assessment in tumor tissues can aid in treatment decision making.
24288670 The aim of this study was to monitor serum levels of two microRNAs (miR-21 and miR-141) and three kallikreins (hK3/PSA, hK11, and hK13) before and 1, 5, and 30 days after radical prostatectomy.
23371469 KLK13 may play an important role in regulating cellular migration and invasiveness, making the loss of KLK13 a potential biomarker for early detection of lymph node metastasis in oral squamous cell carcinomas.
22948777 High KLK13 expression is associated with drug response in gastric cancer.
21741862 Data indicate that five out of 9 SNPs in the KLK13 gene were associated with prostate cancer risk and/or aggressiveness.
21689719 Results indicate that KLK13 may play a role in the defense of the upper digestive apparatus and in male reproductive organs.
21596022 these results reveal the enhancing effects of KLK13 on tumor cell invasion and migration, and that it may serve as a diagnostic/prognostic marker and a potential therapeutic target for lung cancer.
21439340 Serine protease of Kazal-type (SPINK6) expressed in normal human skin is a potent natural inhibitor of Kallikrein-related peptidases, KLK12 and KLK13.
20678496 This is the first study disclosing the possible clinical utility of KLK13 as a new tumor biomarker capable of predicting a favorable outcome for gastric cancer patients.
20424135 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKW      1 - 70
VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYI     71 - 140
QTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGG    141 - 210
KDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ       211 - 277
//

Publication (33)

PMID Year Title
25677900 2015 Kallikrein-related peptidase 13: an independent indicator of favorable prognosis for patients with nonsmall cell lung cancer.
24288670 2013 Circulating microRNAs and kallikreins before and after radical prostatectomy: are they really prostate cancer markers?
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23371469 2014 Decreased expression of kallikrein-related peptidase 13: possible contribution to metastasis of human oral cancer.
22948777 2012 The kallikrein-related peptidase 13 (KLK13) gene is substantially up-regulated after exposure of gastric cancer cells to antineoplastic agents.
21741862 2013 Common variation in Kallikrein genes KLK5, KLK6, KLK12, and KLK13 and risk of prostate cancer and tumor aggressiveness.
21689719 2011 Substrate specificity of kallikrein-related peptidase 13 activated by salts or glycosaminoglycans and a search for natural substrate candidates.
21596022 2011 Epigenetic activation of human kallikrein 13 enhances malignancy of lung adenocarcinoma by promoting N-cadherin expression and laminin degradation.
21439340 2011 Inhibition of kallikrein-related peptidases by the serine protease inhibitor of Kazal-type 6.
20678496 2010 Kallikrein-related peptidase 13 (KLK13) gene expressional status contributes significantly in the prognosis of primary gastric carcinomas.
More...