Property Summary

NCBI Gene PubMed Count 33
PubMed Score 19.33
PubTator Score 26.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.0e-10
ovarian cancer 8520 4.1e-06
osteosarcoma 7950 6.7e-06
non-small cell lung cancer 2890 8.1e-06
adult high grade glioma 3801 1.9e-03
esophageal adenocarcinoma 737 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Burning mouth syndrome 7 3.153 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-03
esophageal adenocarcinoma -3.900 2.0e-02
non-small cell lung cancer 1.261 8.1e-06
osteosarcoma 1.492 6.7e-06
ovarian cancer 1.300 4.1e-06
psoriasis 3.500 1.0e-10

Gene RIF (19)

AA Sequence

MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLVHPKW      1 - 70
VLTAAHCLKEGLKVYLGKHALGRVEAGEQVREVVHSIPHPEYRRSPTHLNHDHDIMLLELQSPVQLTGYI     71 - 140
QTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDEECRQVYPGKITDNMLCAGTKEGG    141 - 210
KDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYTRVSRYVLWIRETIRKYETQQQKWLKGPQ       211 - 277
//

Text Mined References (34)

PMID Year Title