Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.65
PubTator Score 17.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma -2.300 0.022
cutaneous lupus erythematosus 1.700 0.016
psoriasis 1.600 0.000
osteosarcoma 1.938 0.000
non-small cell lung cancer 1.032 0.000
active Crohn's disease 1.563 0.020
active ulcerative colitis 1.544 0.009

Gene RIF (12)

PMID Text
23612974 Kallikrein 5 and kallikrein 12 cleave human influenza hemagglutinins and activate thrombolytic zymogens.
23236234 KLK12 gene is markedly overexpressed in gastric cancer
23152405 the proangiogenic activity of KLK12 in lung endothelial cells was not related to a kinin release
22351561 Results suggest that kallikrein-related peptidase 12 (KLK12) splice variant KLK12sv3 can be regarded as a marker of good prognosis in breast cancer.
21741862 Data indicate that the KLK12 SNP rs3865443 was not associated with tumor aggressiveness but showed marginal association with prostate cancer risk for the rare homozygote.
21628462 KLK12 may indirectly regulate the bioavailability and activity of several growth factors through processing of their CCN binding partners
21439340 Serine protease of Kazal-type (SPINK6) expressed in normal human skin is a potent natural inhibitor of Kallikrein-related peptidases, KLK12 and KLK13.
20424135 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of kallikrein-related peptidase 12 (KLK12) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17391064 KLK12 has trypsin-like activity, cleaving peptide bonds after both arginine & lysine. It quickly loses its activity due to autodegradation, its activity can also be rapidly inhibited by zinc ions & by alpha2-antiplasmin through covalent complex formation.
More...

AA Sequence

MGLSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHCSGSRYWV      1 - 70
RLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTSSVQPLPLPNDCATAGTEC     71 - 140
HVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVL    141 - 210
QGLVSWGSVGPCGQDGIPGVYTYICKYVDWIRMIMRNN                                    211 - 248
//

Publication (23)

PMID Year Title
23612974 2013 Cleavage activation of human-adapted influenza virus subtypes by kallikrein-related peptidases 5 and 12.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23236234 2012 Clinical significance of human kallikrein 12 gene expression in gastric cancer.
23152405 2013 Pro-angiogenic effect of human kallikrein-related peptidase 12 (KLK12) in lung endothelial cells does not depend on kinin-mediated activation of B2 receptor.
22351561 2012 Human kallikrein-related peptidase 12 (KLK12) splice variants expression in breast cancer and their clinical impact.
21741862 2013 Common variation in Kallikrein genes KLK5, KLK6, KLK12, and KLK13 and risk of prostate cancer and tumor aggressiveness.
21628462 2011 Kallikrein-related peptidase 12 hydrolyzes matricellular proteins of the CCN family and modifies interactions of CCN1 and CCN5 with growth factors.
21439340 2011 Inhibition of kallikrein-related peptidases by the serine protease inhibitor of Kazal-type 6.
20424135 2010 Blood biomarker levels to aid discovery of cancer-related single-nucleotide polymorphisms: kallikreins and prostate cancer.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
More...