Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.64
PubTator Score 4.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.3e-135

Gene RIF (5)

AA Sequence

MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLTAAHCRKPYLW      1 - 70
VRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPG     71 - 140
MQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSCQGDSGGPLVC    141 - 210
NGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN                                  211 - 250
//

Text Mined References (14)

PMID Year Title