Property Summary

NCBI Gene PubMed Count 36
PubMed Score 79.56
PubTator Score 48.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
active ulcerative colitis 2.012 4.8e-02
adult high grade glioma 1.300 1.5e-02
Astrocytoma, Pilocytic 1.800 2.7e-08
Breast cancer -1.300 1.4e-04
colon cancer -1.700 1.0e-02
cutaneous lupus erythematosus 1.400 3.0e-02
ductal carcinoma in situ 1.400 1.2e-02
esophageal adenocarcinoma 1.800 3.5e-02
glioblastoma 1.100 2.3e-03
group 3 medulloblastoma -1.200 7.1e-03
intraductal papillary-mucinous adenoma (... 3.500 3.8e-04
intraductal papillary-mucinous carcinoma... 2.800 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.500 2.6e-02
invasive ductal carcinoma 1.408 5.0e-04
lung adenocarcinoma 1.800 4.0e-12
lung cancer -1.400 3.7e-03
lung carcinoma 1.300 4.0e-04
nasopharyngeal carcinoma -1.100 2.0e-02
non-small cell lung cancer 1.145 5.2e-08
osteosarcoma -1.885 1.0e-02
pancreatic cancer -1.100 3.1e-02
pancreatic carcinoma -1.100 3.1e-02
periodontitis 1.500 9.7e-29
pituitary cancer -2.300 9.9e-06
primary pancreatic ductal adenocarcinoma 2.171 5.0e-02
primary Sjogren syndrome 1.700 5.6e-04
psoriasis -2.300 8.2e-05
subependymal giant cell astrocytoma 2.401 4.9e-03
tuberculosis -1.600 1.2e-05
Waldenstrons macroglobulinemia -2.455 1.4e-03

Gene RIF (26)

AA Sequence

MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVL      1 - 70
YLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDASISTCRGLRGYFSQGDQRYFI     71 - 140
EPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDLQQNIALPATKLVKLKDRKVQEHEKYIEYYL    141 - 210
VLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWR    211 - 280
GSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHD    281 - 350
DYSCKCPSTICVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED    351 - 420
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRF    421 - 490
QVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSKYGYCRRVDDTLIPCKANDTM    491 - 560
CGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMVANGTKCGDNKVCINAECVDIEKAYKSTNCS    561 - 630
SKCKGHAVCDHELQCQCEEGWIPPDCDDSSVVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQR    631 - 700
PLSTTGTRPHKQKRKPQMVKAVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKD    701 - 770
SNPKA                                                                     771 - 775
//

Text Mined References (39)

PMID Year Title