Property Summary

NCBI Gene PubMed Count 34
Grant Count 10
R01 Count 5
Funding $1,782,404.5
PubMed Score 74.53
PubTator Score 48.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
25453333 The results of this study suggest that these proteins play important roles in pulmonary inflammatory reactions elicited against etiological viral agents.
24613731 IL-1beta-induced MMP-13 expression and changes in cell proliferation and apoptosis in alpha7(+)hSMSC-OB cells are regulated by ADAM-28.
24007880 Src is an inducer of ADAM28 gene expression through the MEK/extracellular signal-regulated kinase and PI3K/mammalian target of rapamycin pathways.
23643150 High ADAM28 expression is associated with B-Cell Chronic Lymphocytic Leukemia.
23640157 Sequence analysis of ADAM28 genes did not reveal any putative mutations for hyperostosis cranialis interna to chromosome 8p21
23527725 The change of ADAM28 and IGFBP-3 gene expression is present in the normal tissue in overweight/obese patients with colorectal cancer only, and the observed variability of ADAM28 and IGFBP-3 expression may be an initial process of cancer proliferation
23010875 Human ADAM28 expression levels were positively correlated with parameters of the metabolic syndrome.
22636800 ADAM28 cleaves and inactivates proapoptotic VWF in carcinoma cells and enhances lung metastasis probably by promoting carcinoma cell survival within the blood vessels.
21913264 Study shows using proteomics that ADAM28 may be used as a possible biomarker of bladder cancer.
21782798 ADAM28 showed significant differences compared with normal individuals, so it may be a biomarker of bladder cancer.
More...

AA Sequence

MLQGLLPVSLLLSVAVSAIKELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVL      1 - 70
YLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYYQGHILNEKVSDASISTCRGLRGYFSQGDQRYFI     71 - 140
EPLSPIHRDGQEHALFKYNPDEKNYDSTCGMDGVLWAHDLQQNIALPATKLVKLKDRKVQEHEKYIEYYL    141 - 210
VLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTHVALVGMEIWTDKDKIKITPNASFTLENFSKWR    211 - 280
GSVLSRRKRHDIAQLITATELAGTTVGLAFMSTMCSPYSVGVVQDHSDNLLRVAGTMAHEMGHNFGMFHD    281 - 350
DYSCKCPSTICVMDKALSFYIPTDFSSCSRLSYDKFFEDKLSNCLFNAPLPTDIISTPICGNQLVEMGED    351 - 420
CDCGTSEECTNICCDAKTCKIKATFQCALGECCEKCQFKKAGMVCRPAKDECDLPEMCNGKSGNCPDDRF    421 - 490
QVNGFPCHHGKGHCLMGTCPTLQEQCTELWGPGTEVADKSCYNRNEGGSKYGYCRRVDDTLIPCKANDTM    491 - 560
CGKLFCQGGSDNLPWKGRIVTFLTCKTFDPEDTSQEIGMVANGTKCGDNKVCINAECVDIEKAYKSTNCS    561 - 630
SKCKGHAVCDHELQCQCEEGWIPPDCDDSSVVFHFSIVVGVLFPMAVIFVVVAMVIRHQSSREKQKKDQR    631 - 700
PLSTTGTRPHKQKRKPQMVKAVQPQEMSQMKPHVYDLPVEGNEPPASFHKDTNALPPTVFKDNPVSTPKD    701 - 770
SNPKA                                                                     771 - 775
//

Text Mined References (37)

PMID Year Title
25453333 2014 The roles of ADAM33, ADAM28, IL-13 and IL-4 in the development of lung injuries in children with lethal non-pandemic acute infectious pneumonia.
24613731 2014 IL-1?-induced matrix metalloproteinase-13 is activated by a disintegrin and metalloprotease-28-regulated proliferation of human osteoblast-like cells.
24007880 2013 Src plays a key role in ADAM28 expression in v-src-transformed epithelial cells and human carcinoma cells.
23643150 2013 Ectodomain shedding of CD200 from the B-CLL cell surface is regulated by ADAM28 expression.
23640157 2013 Localization of the gene for hyperostosis cranialis interna to chromosome 8p21 with analysis of three candidate genes.
23527725 Expression of ADAM28 and IGFBP-3 genes in patients with colorectal cancer - a preliminary report.
23010875 2012 ADAM28 is elevated in humans with the metabolic syndrome and is a novel sheddase of human tumour necrosis factor-?.
22636800 2012 Effect of ADAM28 on carcinoma cell metastasis by cleavage of von Willebrand factor.
21913264 2011 Urinary protein profiling by liquid chromatography/tandem mass spectrometry: ADAM28 is overexpressed in bladder transitional cell carcinoma.
21782798 2011 Characterization of ADAM28 as a biomarker of bladder transitional cell carcinomas by urinary proteome analysis.
More...