Property Summary

NCBI Gene PubMed Count 37
Grant Count 1
Funding $50,000
PubMed Score 59.21
PubTator Score 85.73

Knowledge Summary

Patent (10,770)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.700 0.000
Multiple Sclerosis 1.400 0.002

Synonym

Accession Q9UKP6 B2RMV8 UR-2-R
Symbols UTR
UTR2
GPR14
UR-2-R

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

Gene RIF (28)

PMID Text
26381851 UTII-R expression on biopsy was associated with Gleason upgrading and pathology upstaging in prostate cancer patients.
25514221 Urotensin II can induce the proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways.
24893613 High UTR expression is an independent prognostic factor of good prognosis for non muscle invasive bladder transitional cancer.
24391740 family-based analysis of association between blood pressure, glomerular filtration and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphisms
24372535 UTR protein and mRNA levels were increased in colon cancer cell lines and in colon adenoma and adenocarcinoma. UTR appears to be involved in the regulation of colon cancer cell invasion and motility.
24357333 Report interaction of urantide with urotensin II receptor.
23344731 Data suggest that UTS2R in aortic endothelium is involved in development of diabetes-associated atherosclerosis; diabetes-associated plaque development is attenuated by urotensin II/UTS2R antagonism in in vitro setting.
22563490 Data show that vasoactive peptide urotensin II receptor and GABA(A)R are co-expressed in cerebellar glial cells from rat brain slices, in human native astrocytes and in glioma cell line.
22245063 presence of functional nuclear UT in various rat and monkey tissues as well as in human cell lines
21080343 Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells.
More...

AA Sequence

MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVVGVVGNA      1 - 70
YTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFGLDFLTMHASIFT     71 - 140
LTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVRRGPKSLCLPAWGPRAHRA    141 - 210
YLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLL    211 - 280
AQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRAR    281 - 350
FQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA                                   351 - 389
//

Text Mined References (39)

PMID Year Title
26381851 2015 Urotensin II receptor on preoperative biopsy is associated with upstaging and upgrading in prostate cancer.
25514221 2014 Up-regulation of urotensin II and its receptor contributes to human hepatocellular carcinoma growth via activation of the PKC, ERK1/2, and p38 MAPK signaling pathways.
24893613 2014 Urotensin II receptor determines prognosis of bladder cancer regulating cell motility/invasion.
24391740 2013 Urotensin-II system in genetic control of blood pressure and renal function.
24372535 2014 Urotensin-II receptor is over-expressed in colon cancer cell lines and in colon carcinoma in humans.
24357333 2014 Urantide conformation and interaction with the urotensin-II receptor.
23344731 2013 Urotensin II receptor antagonism confers vasoprotective effects in diabetes associated atherosclerosis: studies in humans and in a mouse model of diabetes.
22563490 2012 Down-regulation of GABA(A) receptor via promiscuity with the vasoactive peptide urotensin II receptor. Potential involvement in astrocyte plasticity.
22245063 2012 Presence of urotensin-II receptors at the cell nucleus: specific tissue distribution and hypoxia-induced modulation.
21080343 2011 Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells.
More...