Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.37
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKP5 Q59EX6 Q5IR87 Q5IR88 Q5IR89 Q68DL1 ADAM-TS 6
Symbols ADAM-TS6
ADAMTS-6
ADAM-TS 6

Gene

Gene RIF (4)

PMID Text
26686553 Novel inguinal hernia susceptibility genes are identified as EFEMP1, WT1, EBF2 and ADAMTS6.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18579725 The gain of function studies indicated that ADAM metallopeptidase with thrombospondin type 1 motif 6 activate NR5A1 gene expression.
16129570 Study shows that the ADAMTS6 transcript contains unusually large untranslated regions (UTRs) at both the 5' and 3'end, and the 5'UTR contains 11 AUG codons upstream of the predicted ADAMTS6 start codon.

AA Sequence

MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFTVKNDKHSRRR      1 - 70
RSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDGPQWKHDFLDNCHYTGYLQDQ     71 - 140
RSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSALQQRHLYDHSHCGVS    141 - 210
DFTRSGKPWWLNDTSTVSYSLPINNTHIHHRQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMN    211 - 280
IVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHH    281 - 350
DNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC    351 - 420
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQC    421 - 490
RFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKGWCYQGDCVPFGTWPQSIDGG    491 - 560
WGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGERKRYRSCNTDPCPLGSRDFREKQCADFDNM    561 - 630
PFRGKYYNWKPYTGGGVKPCALNCLAEGYNFYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSD    631 - 700
AREDRCRVCGGDGSTCDAIEGFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYING    701 - 770
AWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV    771 - 840
GFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWLE    841 - 910
CSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPCNNQSCPPQWVALDWSECTPKCGPGFK    911 - 980
HRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPPRWVTGDWGQCSAQCGLGQQMRTVQCLSYTG    981 - 1050
QASSDCLETVRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH      1051 - 1117
//

Publication (16)

PMID Year Title
26686553 2015 A genome-wide association study identifies four novel susceptibility loci underlying inguinal hernia.
26025392 2015 The ADAMTS (A Disintegrin and Metalloproteinase with Thrombospondin motifs) family.
25250687 2014 Disruption of the ARID1B and ADAMTS6 loci due to a t(5;6)(q12.3;q25.3) in a patient with developmental delay.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23212062 2012 Genome-wide association study of clinical dimensions of schizophrenia: polygenic effect on disorganized symptoms.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18579725 2008 Identification of NR5A1 (SF-1/AD4BP) gene expression modulators by large-scale gain and loss of function studies.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16129570 2005 Analysis of full length ADAMTS6 transcript reveals alternative splicing and a role for the 5' untranslated region in translational control.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
More...