Property Summary

NCBI Gene PubMed Count 22
Grant Count 13
R01 Count 5
Funding $1,477,803.25
PubMed Score 28.79
PubTator Score 15.92

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (8)

Gene RIF (13)

PMID Text
26872430 The main contribution of this study is the proposal of a pharmacophore for ADAMTS7.
26446668 Our results indicate the presence of ADAMTS-7 in human NP cells and imply its potential role in disc degeneration.
26189211 The significant associations observed between this coding variant in ADAMTS7 and the risk of CAD development.
25885961 Logistic regression analysis indicated that the association between ADAMTS-7 and heart failure after AMI was independent from traditional cardiovascular risk factors and other biomarkers
25712206 ADAMTS7 localized to cells having smooth muscle cell markers in human coronary artery disease lesions. Cultured vascular smooth muscle cells had ADAMTS7 at the cytoplasm and cell membrane, where it colocalized with markers of podosomes.
25653475 Data conclude that ADAMTS-7 level appears to be positively associated with expression of TNF-alpha and Phospho-NF-kappaB P65 in cartilage, which may imply its association with cartilage destruction of ONFH.
23415669 There was a reduction in the amount of cleaved ADAMTS7 prodomain in media conditioned by VSMCs of the G/G genotype.
22247065 statistically significant increase in mRNA expression of ADAMTS-7 and ADAMTS-12 was observed in the endplate cells in degenerative discs compared with nondegenerative discs
21239051 identified ADAMTS7 as novel locus for CAD and association of ABO with MI in the presence of CAD
20718794 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPGGPSPRSPAPLLRPLLLLLCALAPGAPGPAPGRATEGRAALDIVHPVRVDAGGSFLSYELWPRALRKR      1 - 70
DVSVRRDAPAFYELQYRGRELRFNLTANQHLLAPGFVSETRRRGGLGRAHIRAHTPACHLLGEVQDPELE     71 - 140
GGLAAISACDGLKGVFQLSNEDYFIEPLDSAPARPGHAQPHVVYKRQAPERLAQRGDSSAPSTCGVQVYP    141 - 210
ELESRRERWEQRQQWRRPRLRRLHQRSVSKEKWVETLVVADAKMVEYHGQPQVESYVLTIMNMVAGLFHD    211 - 280
PSIGNPIHITIVRLVLLEDEEEDLKITHHADNTLKSFCKWQKSINMKGDAHPLHHDTAILLTRKDLCAAM    281 - 350
NRPCETLGLSHVAGMCQPHRSCSINEDTGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFIMSPQLL    351 - 420
YDAAPLTWSRCSRQYITRFLDRGWGLCLDDPPAKDIIDFPSVPPGVLYDVSHQCRLQYGAYSAFCEDMDN    421 - 490
VCHTLWCSVGTTCHSKLDAAVDGTRCGENKWCLSGECVPVGFRPEAVDGGWSGWSAWSICSRSCGMGVQS    491 - 560
AERQCTQPTPKYKGRYCVGERKRFRLCNLQACPAGRPSFRHVQCSHFDAMLYKGQLHTWVPVVNDVNPCE    561 - 630
LHCRPANEYFAEKLRDAVVDGTPCYQVRASRDLCINGICKNVGCDFEIDSGAMEDRCGVCHGNGSTCHTV    631 - 700
SGTFEEAEGLGYVDVGLIPAGAREIRIQEVAEAANFLALRSEDPEKYFLNGGWTIQWNGDYQVAGTTFTY    701 - 770
ARRGNWENLTSPGPTKEPVWIQLLFQESNPGVHYEYTIHREAGGHDEVPPPVFSWHYGPWTKCTVTCGRG    771 - 840
VQRQNVYCLERQAGPVDEEHCDPLGRPDDQQRKCSEQPCPARWWAGEWQLCSSSCGPGGLSRRAVLCIRS    841 - 910
VGLDEQSALEPPACEHLPRPPTETPCNRHVPCPATWAVGNWSQCSVTCGEGTQRRNVLCTNDTGVPCDEA    911 - 980
QQPASEVTCSLPLCRWPLGTLGPEGSGSGSSSHELFNEADFIPHHLAPRPSPASSPKPGTMGNAIEEEAP    981 - 1050
ELDLPGPVFVDDFYYDYNFINFHEDLSYGPSEEPDLDLAGTGDRTPPPHSHPAAPSTGSPVPATEPPAAK   1051 - 1120
EEGVLGPWSPSPWPSQAGRSPPPPSEQTPGNPLINFLPEEDTPIGAPDLGLPSLSWPRVSTDGLQTPATP   1121 - 1190
ESQNDFPVGKDSQSQLPPPWRDRTNEVFKDDEEPKGRGAPHLPPRPSSTLPPLSPVGSTHSSPSPDVAEL   1191 - 1260
WTGGTVAWEPALEGGLGPVDSELWPTVGVASLLPPPIAPLPEMKVRDSSLEPGTPSFPTPGPGSWDLQTV   1261 - 1330
AVWGTFLPTTLTGLGHMPEPALNPGPKGQPESLSPEVPLSSRLLSTPAWDSPANSHRVPETQPLAPSLAE   1331 - 1400
AGPPADPLVVRNAGWQAGNWSECSTTCGLGAVWRPVRCSSGRDEDCAPAGRPQPARRCHLRPCATWHSGN   1401 - 1470
WSKCSRSCGGGSSVRDVQCVDTRDLRPLRPFHCQPGPAKPPAHRPCGAQPCLSWYTSSWRECSEACGGGE   1471 - 1540
QQRLVTCPEPGLCEEALRPNTTRPCNTHPCTQWVVGPWGQCSGPCGGGVQRRLVKCVNTQTGLPEEDSDQ   1541 - 1610
CGHEAWPESSRPCGTEDCEPVEPPRCERDRLSFGFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGH   1611 - 1680
QRVARR                                                                   1681 - 1686
//

Publication (24)

PMID Year Title
26872430 2016 Classification of ADAMTS binding sites: The first step toward selective ADAMTS7 inhibitors.
26446668 2015 IL-17A enhances ADAMTS-7 expression through regulation of TNF-? in human nucleus pulposus cells.
26189211 2016 ADAMTS7 locus confers high cross-race risk for development of coronary atheromatous plaque.
25885961 2015 Association between plasma ADAMTS-7 levels and ventricular remodeling in patients with acute myocardial infarction.
25712206 2015 Knockout of Adamts7, a novel coronary artery disease locus in humans, reduces atherosclerosis in mice.
25653475 2015 ADAMTS-7 exhibits elevated expression in cartilage of osteonecrosis of femoral head and has a positive correlation with TNF- ? and NF- ? B P65.
24262325 2014 Shared genetic susceptibility to ischemic stroke and coronary artery disease: a genome-wide analysis of common variants.
23561647 2013 Genome-wide association study of coronary and aortic calcification implicates risk loci for coronary artery disease and myocardial infarction.
23415669 2013 ADAMTS7 cleavage and vascular smooth muscle cell migration is affected by a coronary-artery-disease-associated variant.
22247065 2012 Negative effects of ADAMTS-7 and ADAMTS-12 on endplate cartilage differentiation.
More...