Property Summary

NCBI Gene PubMed Count 12
PubMed Score 15.87
PubTator Score 7.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession Q9UKP3 Q32N04 Q549J7
Symbols CHORDC3
ITGB1BP
MELUSIN
MSTP015

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLP      1 - 70
EAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLD     71 - 140
SLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDW    141 - 210
GKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSS    211 - 280
VFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE       281 - 347
//

Text Mined References (14)

PMID Year Title