Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.35
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.9e-06
ovarian cancer 8520 3.2e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 2.92942457748925E-7
Disease Target Count Z-score Confidence
Infectious mononucleosis 14 3.672 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.100 2.9e-07
osteosarcoma -1.585 2.9e-06
ovarian cancer 1.900 3.2e-05

 MGI Phenotype (1)

Gene RIF (5)

AA Sequence

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA      1 - 70
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP     71 - 140
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ    141 - 210
IAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGD    211 - 280
EEGLLTHSEEELEHSQDTDADDGALQ                                                281 - 306
//

Text Mined References (38)

PMID Year Title