Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.37
PubTator Score 10.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
osteosarcoma 7933 2.89000566897091E-6
ovarian cancer 8492 3.18170073853807E-5
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 2.0
Disease Target Count Z-score Confidence
Infectious mononucleosis 15 3.759 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.585 0.000
ovarian cancer 1.900 0.000
Breast cancer 1.100 0.000

Synonym

Accession Q9UKM9 Q14621 Q2M365 Q5QPL8 Q9BQX6 Q9UJE3
Symbols P542
HNRPCL2

Gene

PDB

1WF1  

  Ortholog (11)

 MGI Term (1)

Pathway (1)

Gene RIF (2)

PMID Text
22994768 People with lower level of RALYL expression had a poorer survival rate.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFVQYSNERHARA      1 - 70
AVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYRDDFYDRLFDYRGRLSPVPVP     71 - 140
RAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIKTELTQIKSNIDALLSRLEQ    141 - 210
IAAEQKANPDGKKKGDGGGAGGGGGGGGSGGGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGD    211 - 280
EEGLLTHSEEELEHSQDTDADDGALQ                                                281 - 306
//

Text Mined References (34)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23614458 2013 Proteome-wide characterization of the RNA-binding protein RALY-interactome using the in vivo-biotinylation-pulldown-quant (iBioPQ) approach.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22994768 2012 RALY RNA binding protein-like reduced expression is associated with poor prognosis in clear cell renal cell carcinoma.
22976474 2012 A meta-analysis of genome-wide association studies of breast cancer identifies two novel susceptibility loci at 6q14 and 20q11.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...