Property Summary

NCBI Gene PubMed Count 16
Grant Count 62
R01 Count 40
Funding $9,071,036.63
PubMed Score 53.31
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.200 0.000
astrocytoma 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.310 0.002
lung cancer -2.200 0.000
lung adenocarcinoma -1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q9UKL6 Q9BSC9 Q9UIT3 Q9UKW7 PC-TP
Symbols PC-TP
STARD2

Gene

PANTHER Protein Class (1)

PDB

1LN1   1LN2   1LN3  

Gene RIF (10)

PMID Text
24216752 PC-TP contributes to the racial difference in PAR4-mediated platelet activation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of phosphatidylcholine transfer protein (PCTP) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18676680 Observational study of gene-disease association. (HuGE Navigator)
17704541 Yeast two-hybrid screening using libraries prepared from mouse liver and embryo identified Them2 (thioesterase superfamily member 2) and the homeodomain transcription factor Pax3 (paired box gene 3), respectively, as PC-TP-interacting proteins.
17266964 phosphatidylcholine transfer protein gene variants are associated with LDL-peak particle size
12055623 crystal structures of human PC-TP in complex with dilinoleoyl-PtdCho or palmitoyl-linoleoyl-PtdCho reveal that a single well-ordered PtdCho molecule occupies a centrally located tunnel

AA Sequence

MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD      1 - 70
IYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSM     71 - 140
PQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY    141 - 210
LKKT                                                                      211 - 214
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24216752 2013 Racial differences in human platelet PAR4 reactivity reflect expression of PCTP and miR-376c.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22021425 2012 Genome-wide association study of body height in African Americans: the Women's Health Initiative SNP Health Association Resource (SHARe).
21269460 2011 Initial characterization of the human central proteome.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
More...