Property Summary

NCBI Gene PubMed Count 17
PubMed Score 56.29
PubTator Score 19.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 2.2e-16
lung adenocarcinoma -1.100 4.3e-07
lung cancer -2.200 5.9e-05
ovarian cancer 1.700 2.3e-04
pancreatic ductal adenocarcinoma liver m... -2.310 2.0e-03
psoriasis -1.200 8.2e-05

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLAD      1 - 70
IYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSM     71 - 140
PQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNY    141 - 210
LKKT                                                                      211 - 214
//

Text Mined References (21)

PMID Year Title