Property Summary

NCBI Gene PubMed Count 29
PubMed Score 326.86
PubTator Score 80.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myopia 176 4.268 2.1
Refractive Errors 3 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Epilepsy 792 4.447 2.2

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.200 1.1e-03
facioscapulohumeral dystrophy 2.500 4.1e-05
lung carcinoma 1.500 2.4e-23
medulloblastoma, large-cell 1.400 7.1e-04
osteosarcoma 1.182 1.1e-05
ovarian cancer 1.200 2.3e-10
psoriasis -2.100 7.5e-07

Gene RIF (23)

AA Sequence

MGEWTILERLLEAAVQQHSTMIGRILLTVVVIFRILIVAIVGETVYDDEQTMFVCNTLQPGCNQACYDRA      1 - 70
FPISHIRYWVFQIIMVCTPSLCFITYSVHQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKR     71 - 140
EDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNALE    141 - 210
IGFLVGQYFLYGFSVPGLYECNRYPCIKEVECYVSRPTEKTVFLVFMFAVSGICVVLNLAELNHLGWRKI    211 - 280
KLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAYV                                 281 - 321
//

Text Mined References (30)

PMID Year Title