Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.58

Knowledge Summary

Patent (466)


  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 2.43563099753757E-7
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Disease Target Count Z-score Confidence
Thalassemia 46 3.428 1.7


Accession Q9UKL2 Q6IF31
Symbols HPFH1OR


  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Horse OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (2)

20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of olfactory receptor, family 52, subfamily A, member 1 (OR52A1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

SIYLLVPPFLNPLVYGAKTTQIRIHVVKMFCS                                          281 - 312

Text Mined References (7)

PMID Year Title
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10512676 1999 An olfactory receptor gene is located in the extended human beta-globin gene cluster and is expressed in erythroid cells.