Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00
PubTator Score 0.58

Knowledge Summary

Patent (466)

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 2.4e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Disease Target Count Z-score Confidence
Thalassemia 53 3.44 1.7

Gene RIF (2)

AA Sequence

MSISNITVYMPSVLTLVGIPGLESVQCWIGIPFCAIYLIAMIGNSLLLSIIKSERSLHEPLYIFLGMLGA      1 - 70
TDIALASSIMPKMLGIFWFNVPEIYFDSCLLQMWFIHTLQGIESGILVAMALDRYVAICYPLRHANIFTH     71 - 140
QLVIQIGTMVVLRAAILVAPCLVLIKCRFQFYHTTVISHSYCEHMAIVKLAAANVQVNKIYGLFVAFTVA    141 - 210
GFDLTFITLSYIQIFITVFRLPQKEARFKAFNTCIAHICVFLQFYLLAFFSFFTHRFGSHISPYIHILFS    211 - 280
SIYLLVPPFLNPLVYGAKTTQIRIHVVKMFCS                                          281 - 312
//

Text Mined References (7)

PMID Year Title