Property Summary

NCBI Gene PubMed Count 51
Grant Count 59
R01 Count 30
Funding $5,117,392.38
PubMed Score 74.31
PubTator Score 58.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.000
adult high grade glioma -1.100 0.000
sonic hedgehog group medulloblastoma 1.200 0.001
ovarian cancer 1.600 0.003
dermatomyositis 1.100 0.004

Synonym

Accession Q9UKL0 Q15044 Q6P2I9 Q86VG5
Symbols RCOR
COREST

Gene

PDB

2IW5   2UXN   2UXX   2V1D   2X0L   2XAF   2XAG   2XAH   2XAJ   2XAQ   2XAS   2Y48   3ZMS   3ZMT   3ZMU   3ZMV   3ZMZ   3ZN0   3ZN1   4BAY   4KUM   4UV8   4UV9   4UVA   4UVB   4UVC   4UXN   4XBF   5L3B   5L3C   5L3D   5L3F   5LBQ  

Gene RIF (23)

PMID Text
26119982 Rcor1 knock-out monocytes exhibited extensive self-renewal associated with hematopoietic stem cell expansion.
25916846 The results suggest that LSD1/CoREST interacts with extranucleosomal DNA when it productively engages its nucleosome substrate.
25730864 results suggest that LSD1-CoREST functions as an ergonomic clamp that induces the detachment of the H3 histone tail from the nucleosomal DNA to make it available for capture by the enzyme active site.
25395426 Genomic deletions in RCOR1 are associated with a specific gene expression signature and with unfavorable clinical outcomes in diffuse large B-cell lymphoma patients.
23800350 a combination of virtual screening and biological approaches can lead to compounds reducing REST complex formation
23349832 Data show that miR-22 specifically interacts with the 3' UTRs of the Rcor1, Rgs2 and HDAC4 mRNAs.
22802671 the H3 binding pocket is a central target site to (i) switch off LSD1 amino oxidase activity, thus H3-tail demethylation; (ii) block the competitive binding of transcription factors; and (iii) prevent chromatin anchoring to LSD1/CoREST.
22399799 Gfi-1B p32 isoform binds to Gfi-1B target gene promoters and associates with the LSD1-CoREST repressor complex more efficiently than the major Gfi-1B p37 isoform
21876670 LSD1/KDM1 and CoREST proteins are recruited to the HIV-1 LTR in response to HIV-1 Tat and formation of the LSD1/KDM1/CoREST complex functions as a co-activator of HIV-1 transcription
21300290 Transciption factor SNAIL1 mimics the histone H3 tail and binds to the histone demethylase LSD1-transcription co-repressor (CoREST) complex. The crystal structure of the complex is given here.
More...

AA Sequence

MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSL      1 - 70
AAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQN     71 - 140
LSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKT    141 - 210
FHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKES    211 - 280
KKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQ    281 - 350
NIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNF    351 - 420
FVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS            421 - 482
//

Text Mined References (58)

PMID Year Title
26226427 2015 A rationally-designed chimeric KDM1A/KDM1B histone demethylase tower domain deletion mutant retaining enzymatic activity.
26119982 2015 The Corepressor Rcor1 Is Essential for Normal Myeloerythroid Lineage Differentiation.
25916846 2015 Extranucleosomal DNA enhances the activity of the LSD1/CoREST histone demethylase complex.
25730864 2015 Interplay among nucleosomal DNA, histone tails, and corepressor CoREST underlies LSD1-mediated H3 demethylation.
25395426 2015 An RCOR1 loss-associated gene expression signature identifies a prognostically significant DLBCL subgroup.
24217620 2013 The histone demethylase LSD1/KDM1A promotes the DNA damage response.
23800350 2013 Binding of the repressor complex REST-mSIN3b by small molecules restores neuronal gene transcription in Huntington's disease models.
23592795 2013 SFMBT1 functions with LSD1 to regulate expression of canonical histone genes and chromatin-related factors.
23349832 2013 MicroRNA-22 (miR-22) overexpression is neuroprotective via general anti-apoptotic effects and may also target specific Huntington's disease-related mechanisms.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...