Tbio | REST corepressor 1 |
Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.
This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). [provided by RefSeq, Aug 2011]
This gene encodes a protein that is well-conserved, downregulated at birth, and with a specific role in determining neural cell differentiation. The encoded protein binds to the C-terminal domain of REST (repressor element-1 silencing transcription factor). [provided by RefSeq, Aug 2011]
Comments
Disease | Target Count |
---|---|
IGA Glomerulonephritis | 454 |
Disease | Target Count | P-value |
---|---|---|
medulloblastoma, large-cell | 6234 | 3.01146859789719E-5 |
adult high grade glioma | 2148 | 1.95578824335938E-4 |
sonic hedgehog group medulloblastoma | 1482 | 0.00128686772520297 |
ovarian cancer | 8492 | 0.0030702577713874 |
dermatomyositis | 967 | 0.00444257117079291 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Allergic hypersensitivity disease | 123 | 3.595 | 1.8 |
FG syndrome | 17 | 3.374 | 1.7 |
Disease | log2 FC | p |
---|---|---|
medulloblastoma, large-cell | -1.100 | 0.000 |
adult high grade glioma | -1.100 | 0.000 |
sonic hedgehog group medulloblastoma | 1.200 | 0.001 |
ovarian cancer | 1.600 | 0.003 |
dermatomyositis | 1.100 | 0.004 |
Species | Source |
---|---|
Mouse | OMA Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Cow | OMA Inparanoid |
Pig | OMA Inparanoid |
Xenopus | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
26119982 | Rcor1 knock-out monocytes exhibited extensive self-renewal associated with hematopoietic stem cell expansion. |
25916846 | The results suggest that LSD1/CoREST interacts with extranucleosomal DNA when it productively engages its nucleosome substrate. |
25730864 | results suggest that LSD1-CoREST functions as an ergonomic clamp that induces the detachment of the H3 histone tail from the nucleosomal DNA to make it available for capture by the enzyme active site. |
25395426 | Genomic deletions in RCOR1 are associated with a specific gene expression signature and with unfavorable clinical outcomes in diffuse large B-cell lymphoma patients. |
23800350 | a combination of virtual screening and biological approaches can lead to compounds reducing REST complex formation |
23349832 | Data show that miR-22 specifically interacts with the 3' UTRs of the Rcor1, Rgs2 and HDAC4 mRNAs. |
22802671 | the H3 binding pocket is a central target site to (i) switch off LSD1 amino oxidase activity, thus H3-tail demethylation; (ii) block the competitive binding of transcription factors; and (iii) prevent chromatin anchoring to LSD1/CoREST. |
22399799 | Gfi-1B p32 isoform binds to Gfi-1B target gene promoters and associates with the LSD1-CoREST repressor complex more efficiently than the major Gfi-1B p37 isoform |
21876670 | LSD1/KDM1 and CoREST proteins are recruited to the HIV-1 LTR in response to HIV-1 Tat and formation of the LSD1/KDM1/CoREST complex functions as a co-activator of HIV-1 transcription |
21300290 | Transciption factor SNAIL1 mimics the histone H3 tail and binds to the histone demethylase LSD1-transcription co-repressor (CoREST) complex. The crystal structure of the complex is given here. |
More... |
MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSL 1 - 70 AAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQN 71 - 140 LSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKT 141 - 210 FHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKES 211 - 280 KKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQ 281 - 350 NIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNF 351 - 420 FVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS 421 - 482 //
PMID | Year | Title |
---|---|---|
26226427 | 2015 | A rationally-designed chimeric KDM1A/KDM1B histone demethylase tower domain deletion mutant retaining enzymatic activity. |
26119982 | 2015 | The Corepressor Rcor1 Is Essential for Normal Myeloerythroid Lineage Differentiation. |
25916846 | 2015 | Extranucleosomal DNA enhances the activity of the LSD1/CoREST histone demethylase complex. |
25730864 | 2015 | Interplay among nucleosomal DNA, histone tails, and corepressor CoREST underlies LSD1-mediated H3 demethylation. |
25395426 | 2015 | An RCOR1 loss-associated gene expression signature identifies a prognostically significant DLBCL subgroup. |
24217620 | 2013 | The histone demethylase LSD1/KDM1A promotes the DNA damage response. |
23800350 | 2013 | Binding of the repressor complex REST-mSIN3b by small molecules restores neuronal gene transcription in Huntington's disease models. |
23592795 | 2013 | SFMBT1 functions with LSD1 to regulate expression of canonical histone genes and chromatin-related factors. |
23349832 | 2013 | MicroRNA-22 (miR-22) overexpression is neuroprotective via general anti-apoptotic effects and may also target specific Huntington's disease-related mechanisms. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
More... |