Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.32
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (5)

Gene RIF (9)

PMID Text
27257257 In the presence of pyrophosphate, ADP-ribose is used by the pyrophosphatase NUDIX5 to generate nuclear ATP.
23581889 The NUDT5 protein could play significant roles in the prevention of RNA oxidation and survival in human fibroblast cells.
22200976 Results suggest that the NUDT5 protein may play significant roles in regulating the G1-S transition in HeLa cells.
21768126 The broad substrate specificity of hNUDT5 is achieved by a diversity of not only substrate recognition, but also hydrolysis mechanisms.
21389046 The human NUDT5, which has an intrinsic activity to cleave ADP sugars to AMP and sugar phosphate, possesses the ability to degrade 8-oxo-dGDP to the monophosphate.
20144704 human MTH1, MTH2, and NUDT5 proteins act as a defense against the mutagenesis induced by oxidized dGTP.
19699693 NUDT5 protein eliminates various oxidized deoxyribonucleoside diphosphates from the nucleotide pool and prevents their toxic effects.
18462755 Results report the crystal structure of hNUDT5 in complex with a non-hydrolyzable ADPR analogue, alpha,beta-methyleneadenosine diphosphoribose, and three Mg(2+) ions representing the transition state of the enzyme during catalysis.
12717453 degrades 8-oxo-dGDP to 8-oxo-dGMP, an unusable form for DNA synthesis, and promotes the cleavage of 8-oxo-dGTP by MTH1 to yield 8-oxo-dGMP also

AA Sequence

MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR      1 - 70
TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT     71 - 140
IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK    141 - 210
PFEVPFLKF                                                                 211 - 219
//

Text Mined References (35)

PMID Year Title
27257257 2016 ADP-ribose-derived nuclear ATP synthesis by NUDIX5 is required for chromatin remodeling.
23581889 2013 Lowered Nudix type 5 expression leads to cellular senescence in IMR-90 fibroblast cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22351996 2011 [Mechanistic insight into hydrolysis of oxidized nucleotide diphosphates by human NUDT5].
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22200976 2012 Lowered nudix type 5 (NUDT5) expression leads to cell cycle retardation in HeLa cells.
21768126 2011 Diverse substrate recognition and hydrolysis mechanisms of human NUDT5.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21389046 2011 Cleavage of oxidized guanine nucleotide and ADP sugar by human NUDT5 protein.
21269460 2011 Initial characterization of the human central proteome.
20176146 2010 Function and metabolism of sirtuin metabolite O-acetyl-ADP-ribose.
20144704 2010 Suppression of mutagenesis by 8-hydroxy-2'-deoxyguanosine 5'-triphosphate (7,8-dihydro-8-oxo-2'-deoxyguanosine 5'-triphosphate) by human MTH1, MTH2, and NUDT5.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19699693 2009 NUDT5 hydrolyzes oxidized deoxyribonucleoside diphosphates with broad substrate specificity.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18462755 2008 Molecular mechanism of ADP-ribose hydrolysis by human NUDT5 from structural and kinetic studies.
17261271 2007 Activation of NUDT5, an ADP-ribose pyrophosphatase, by nitric oxide-mediated ADP-ribosylation.
17052728 2006 Crystal structures of human NUDT5 reveal insights into the structural basis of the substrate specificity.
16716086 2006 Human polynucleotide phosphorylase protein in response to oxidative stress.
16002790 2005 Mammalian enzymes for preventing transcriptional errors caused by oxidative damage.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12717453 2003 A novel mechanism for preventing mutations caused by oxidation of guanine nucleotides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10722730 2000 Cloning and characterization of a new member of the Nudix hydrolases from human and mouse.
10567213 1999 Cloning, expression and characterization of YSA1H, a human adenosine 5'-diphosphosugar pyrophosphatase possessing a MutT motif.
10373642 1999 The MutT motif family of nucleotide phosphohydrolases in man and human pathogens (review).
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.