Property Summary

NCBI Gene PubMed Count 27
PubMed Score 26.32
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKK9 A8K516 Q6IAG0 Q9UH49
Symbols YSA1
YSA1H
YSAH1
hNUDT5

Gene

PANTHER Protein Class (2)

PDB

2DSB   2DSC   2DSD   3AC9   3ACA   3BM4   3L85  

Gene RIF (9)

PMID Text
27257257 In the presence of pyrophosphate, ADP-ribose is used by the pyrophosphatase NUDIX5 to generate nuclear ATP.
23581889 The NUDT5 protein could play significant roles in the prevention of RNA oxidation and survival in human fibroblast cells.
22200976 Results suggest that the NUDT5 protein may play significant roles in regulating the G1-S transition in HeLa cells.
21768126 The broad substrate specificity of hNUDT5 is achieved by a diversity of not only substrate recognition, but also hydrolysis mechanisms.
21389046 The human NUDT5, which has an intrinsic activity to cleave ADP sugars to AMP and sugar phosphate, possesses the ability to degrade 8-oxo-dGDP to the monophosphate.
20144704 human MTH1, MTH2, and NUDT5 proteins act as a defense against the mutagenesis induced by oxidized dGTP.
19699693 NUDT5 protein eliminates various oxidized deoxyribonucleoside diphosphates from the nucleotide pool and prevents their toxic effects.
18462755 Results report the crystal structure of hNUDT5 in complex with a non-hydrolyzable ADPR analogue, alpha,beta-methyleneadenosine diphosphoribose, and three Mg(2+) ions representing the transition state of the enzyme during catalysis.
12717453 degrades 8-oxo-dGDP to 8-oxo-dGMP, an unusable form for DNA synthesis, and promotes the cleavage of 8-oxo-dGTP by MTH1 to yield 8-oxo-dGMP also

AA Sequence

MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQR      1 - 70
TLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCT     71 - 140
IHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAK    141 - 210
PFEVPFLKF                                                                 211 - 219
//

Text Mined References (35)

PMID Year Title
27257257 2016 ADP-ribose-derived nuclear ATP synthesis by NUDIX5 is required for chromatin remodeling.
23581889 2013 Lowered Nudix type 5 expression leads to cellular senescence in IMR-90 fibroblast cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22351996 2011 [Mechanistic insight into hydrolysis of oxidized nucleotide diphosphates by human NUDT5].
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22200976 2012 Lowered nudix type 5 (NUDT5) expression leads to cell cycle retardation in HeLa cells.
21768126 2011 Diverse substrate recognition and hydrolysis mechanisms of human NUDT5.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...