Property Summary

NCBI Gene PubMed Count 20
PubMed Score 28.61
PubTator Score 27.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 2.24570656458842E-7
hepatocellular carcinoma 550 1.92190042529119E-6
Breast cancer 3099 7.54737982029907E-6
group 3 medulloblastoma 2254 2.34370314901702E-5
medulloblastoma, large-cell 6234 2.59862474808243E-4
primitive neuroectodermal tumor 3031 3.04690619169361E-4
pancreatic cancer 2300 0.00579041399106983
glioblastoma 5572 0.00822708791348475
primary pancreatic ductal adenocarcinoma 1271 0.0131757261116237
non primary Sjogren syndrome sicca 840 0.0165242207581517
invasive ductal carcinoma 2950 0.0242127673483438
Disease Target Count Z-score Confidence
St. Louis encephalitis 5 5.122 2.6

Expression

Synonym

Accession Q9UKK6
Symbols P15
MTR2

Gene

PDB

1JKG   1JN5   4WYK  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25628361 Complementary structural, biochemical and cellular techniques indicated that the formation of a symmetric RNA binding platform generated by dimerization of NXF1:NXT1 facilitates the recognition of CTE-RNA and promotes its nuclear export

AA Sequence

MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEF      1 - 70
QISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS     71 - 140
//

Text Mined References (22)

PMID Year Title
25628361 2015 The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
25416956 2014 A proteome-scale map of the human interactome network.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12483225 2003 An efficient protein complex purification method for functional proteomics in higher eukaryotes.
More...