Property Summary

NCBI Gene PubMed Count 20
Grant Count 11
R01 Count 4
Funding $978,306.3
PubMed Score 28.61
PubTator Score 27.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
25628361 Complementary structural, biochemical and cellular techniques indicated that the formation of a symmetric RNA binding platform generated by dimerization of NXF1:NXT1 facilitates the recognition of CTE-RNA and promotes its nuclear export

AA Sequence

MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEF      1 - 70
QISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS     71 - 140
//

Publication (22)

PMID Year Title
25628361 2015 The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
25416956 2014 A proteome-scale map of the human interactome network.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12483225 2003 An efficient protein complex purification method for functional proteomics in higher eukaryotes.
More...