Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.57
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
group 4 medulloblastoma 1875 8.10663897490134E-6
medulloblastoma, large-cell 6234 5.28855711099248E-4
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Brachydactyly 52 3.337 1.7
Atrial heart septal defect 15 3.104 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.001
group 4 medulloblastoma 1.200 0.000

Synonym

Accession Q9UKJ8 O43507 Q2VPC6 Q32MR0 ADAM 21
Symbols ADAM31
ADAM 21

Gene

  Ortholog (3)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid

 MGI Term (1)

AA Sequence

MAVDGTLVYIRVTLLLLWLGVFLSISGYCQAGPSQHFTSPEVVIPLKVISRGRSAKAPGWLSYSLRFGGQ      1 - 70
KHVVHMRVKKLLVSRHLPVFTYTDDRALLEDQLFIPDDCYYHGYVEAAPESLVVFSACFGGFRGVLKISG     71 - 140
LTYEIEPIRHSATFEHLVYKINSNETQFPAMRCGLTEKEVARQQLEFEEAENSALEPKSAGDWWTHAWFL    141 - 210
ELVVVVNHDFFIYSQSNISKVQEDVFLVVNIVDSMYKQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFS    211 - 280
QWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQ    281 - 350
HDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKRCGNGVVEREEQC    351 - 420
DCGSVQQCEQDACCLLNCTLRPGAACAFGLCCKDCKFMPSGELCRQEVNECDLPEWCNGTSHQCPEDRYV    421 - 490
QDGIPCSDSAYCYQKRCNNHDQHCREIFGKDAKSASQNCYKEINSQGNRFGHCGINGTTYLKCHISDVFC    491 - 560
GRVQCENVRDIPLLQDHFTLQHTHINGVTCWGIDYHLRMNISDIGEVKDGTVCGPGKICIHKKCVSLSVL    561 - 630
SHVCLPETCNMKGICNNKHHCHCGYGWSPPYCQHRGYGGSIDSGPASAKRGVFLPLIVIPSLSVLTFLFT    631 - 700
VGLLMYLRQCSGPKETKAHSSG                                                    701 - 722
//

Text Mined References (6)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10524237 1999 The identification of seven metalloproteinase-disintegrin (ADAM) genes from genomic libraries.
9469942 1998 ADAM 20 and 21; two novel human testis-specific membrane metalloproteases with similarity to fertilin-alpha.