Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.37
PubTator Score 3.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
group 4 medulloblastoma 1855 8.1e-06
medulloblastoma, large-cell 6241 5.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Brachydactyly 156 3.192 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.200 8.1e-06
medulloblastoma, large-cell 1.200 5.3e-04

 MGI Phenotype (1)

AA Sequence

MAVDGTLVYIRVTLLLLWLGVFLSISGYCQAGPSQHFTSPEVVIPLKVISRGRSAKAPGWLSYSLRFGGQ      1 - 70
KHVVHMRVKKLLVSRHLPVFTYTDDRALLEDQLFIPDDCYYHGYVEAAPESLVVFSACFGGFRGVLKISG     71 - 140
LTYEIEPIRHSATFEHLVYKINSNETQFPAMRCGLTEKEVARQQLEFEEAENSALEPKSAGDWWTHAWFL    141 - 210
ELVVVVNHDFFIYSQSNISKVQEDVFLVVNIVDSMYKQLGTYIILIGIEIWNQGNVFPMTSIEQVLNDFS    211 - 280
QWKQISLSQLQHDAAHMFIKNSLISILGLAYVAGICRPPIDCGVDNFQGDTWSLFANTVAHELGHTLGMQ    281 - 350
HDEEFCFCGERGCIMNTFRVPAEKFTNCSYADFMKTTLNQGSCLHNPPRLGEIFMLKRCGNGVVEREEQC    351 - 420
DCGSVQQCEQDACCLLNCTLRPGAACAFGLCCKDCKFMPSGELCRQEVNECDLPEWCNGTSHQCPEDRYV    421 - 490
QDGIPCSDSAYCYQKRCNNHDQHCREIFGKDAKSASQNCYKEINSQGNRFGHCGINGTTYLKCHISDVFC    491 - 560
GRVQCENVRDIPLLQDHFTLQHTHINGVTCWGIDYHLRMNISDIGEVKDGTVCGPGKICIHKKCVSLSVL    561 - 630
SHVCLPETCNMKGICNNKHHCHCGYGWSPPYCQHRGYGGSIDSGPASAKRGVFLPLIVIPSLSVLTFLFT    631 - 700
VGLLMYLRQCSGPKETKAHSSG                                                    701 - 722
//

Text Mined References (6)

PMID Year Title