Property Summary

NCBI Gene PubMed Count 11
PubMed Score 125.01
PubTator Score 17.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Leukemia, Myelocytic, Acute 113
Disease Target Count P-value
juvenile dermatomyositis 1189 1.80243452387743E-10
tuberculosis 1563 1.76149536914399E-7
osteosarcoma 7933 2.90355436769853E-5
posterior fossa group B ependymoma 1530 3.08270755551462E-4
lung cancer 4473 9.83212351204136E-4
aldosterone-producing adenoma 664 0.01269321745693
glioblastoma 5572 0.0282201595072731
group 3 medulloblastoma 2254 0.0285914290151446
spina bifida 1064 0.035817889435841
Disease Target Count
Leukemia, Acute Myeloid 17

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.499 0.000
glioblastoma 1.600 0.028
juvenile dermatomyositis 1.161 0.000
tuberculosis -1.400 0.000
lung cancer -1.200 0.001
group 3 medulloblastoma 1.200 0.029
posterior fossa group B ependymoma 1.100 0.000
aldosterone-producing adenoma -1.284 0.013
spina bifida -1.703 0.036

Synonym

Accession Q9UKJ5 B2R639
Symbols BTL

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (2)

PMID Text
19118897 studied a new FISH method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocation in patients with myeloid neoplasms associated with eosinophilia
12842979 used fluorescence in situ hybridization to detect deletion of the CHIC2 locus at 4q12 as a surrogate for the FIP1L1-PDGFRA fusion and was observed in bone marrow cells for 3 of 5 patients with systemic mast cell disease associated with eosinophilia

AA Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR      1 - 70
VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK     71 - 140
CETNNMMEYVILIEFLPKTPIFRPD                                                 141 - 165
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
19118897 2009 Validation of a new three-color fluorescence in situ hybridization (FISH) method to detect CHIC2 deletion, FIP1L1/PDGFRA fusion and PDGFRA translocations.
19060904 2009 An empirical framework for binary interactome mapping.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842979 2003 CHIC2 deletion, a surrogate for FIP1L1-PDGFRA fusion, occurs in systemic mastocytosis associated with eosinophilia and predicts response to imatinib mesylate therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...