Property Summary

NCBI Gene PubMed Count 11
PubMed Score 132.06
PubTator Score 17.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.284 1.3e-02
glioblastoma 1.600 2.8e-02
group 3 medulloblastoma 1.200 2.9e-02
juvenile dermatomyositis 1.161 1.8e-10
lung cancer -1.200 9.8e-04
osteosarcoma 1.499 2.9e-05
posterior fossa group B ependymoma 1.100 3.1e-04
spina bifida -1.703 3.6e-02
tuberculosis -1.400 1.8e-07

Gene RIF (2)

AA Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINR      1 - 70
VNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRK     71 - 140
CETNNMMEYVILIEFLPKTPIFRPD                                                 141 - 165
//

Text Mined References (12)

PMID Year Title