Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.40
PubTator Score 16.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.200 8.2e-03
invasive ductal carcinoma 1.036 3.7e-05
lung cancer -1.400 9.7e-03
lung carcinoma -1.500 2.5e-18
mucosa-associated lymphoid tissue lympho... 1.461 1.2e-02
non-small cell lung cancer -1.197 4.7e-17
osteosarcoma -2.580 1.3e-05
psoriasis -1.100 4.4e-04

 CSPA Cell Line (3)

Protein-protein Interaction (10)

Gene RIF (13)

AA Sequence

MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRIS      1 - 70
WRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQ     71 - 140
SIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETAVGVAVAVTVLGIM    141 - 210
ILGLICLLRWRRRKGQQRTKATTPAREPFQNTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSP    211 - 280
RAPPSHRPLKSPQNETLYSVLKA                                                   281 - 303
//

Text Mined References (22)

PMID Year Title