Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.47
PubTator Score 16.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.002
psoriasis -1.100 0.000
osteosarcoma -2.580 0.000
non-small cell lung cancer -1.729 0.000
lung cancer -1.400 0.010
invasive ductal carcinoma 1.036 0.000
lung carcinoma -1.500 0.000
mucosa-associated lymphoid tissue lympho... 1.461 0.012

Synonym

Accession Q9UKJ1 Q8NHI1
Symbols FDF03

Gene

PDB

3WUZ   3WV0   4NFB  

Gene RIF (11)

PMID Text
24889612 PILRalpha exhibits large conformational change to recognize simultaneously both the sTn O-glycan and the compact peptide structure constrained by proline residues
24843130 We demonstrated that three residues (Y2, R95, and W108) presented on the surface of PILRalpha form the sialic acid binding site equivalent to those in siglecs but are arranged in a unique linear mode.
24253495 These results contribute our knowledge of the biological functions of HBVDNAPTP1 and provide novel data to aid in the further analysis of the regulatory mechanism of this protein.
23302878 The amino terminus of herpes simplex virus 1 gK is functionally and physically associated with the gB-PILRalpha protein complex and regulates membrane fusion of the viral envelope with cellular membranes during virus entry.
22695228 The authors show that the human ocular and highly neurovirulent HSV-1 strain McKrae enters substantially more efficiently into cells via the gB-specific human paired immunoglobulin-like type-2 receptor-alpha (hPILR-alpha).
22396535 Data show that PILRalpha/ligand interactions require conserved PILRalpha arginine (Arg)-133 (mouse) and Arg-126 (human).
21241660 These results suggest that PANP is involved in immune regulation as a ligand of the PILRalpha.
19457990 Insertional mutations of gB reduced cell fusion activity when PILRalpha was overexpressed much more than nectin-1.
19244335 viral entry via PILRalpha appears to be conserved but that there is a PILRalpha preference among alphaherpesviruses
18358807 The results demonstrate that cellular receptors for both gB and gD are required for HSV-1 infection and that PILRalpha plays an important role in HSV-1 infection as a coreceptor that associates with gB.
More...

AA Sequence

MGRPLLLPLLPLLLPPAFLQPSGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELATAPDVRIS      1 - 70
WRRGHFHRQSFYSTRPPSIHKDYVNRLFLNWTEGQKSGFLRISNLQKQDQSVYFCRVELDTRSSGRQQWQ     71 - 140
SIEGTKLSITQAVTTTTQRPSSMTTTWRLSSTTTTTGLRVTQGKRRSDSWHISLETAVGVAVAVTVLGIM    141 - 210
ILGLICLLRWRRRKGQQRTKATTPAREPFQNTEEPYENIRNEGQNTDPKLNPKDDGIVYASLALSSSTSP    211 - 280
RAPPSHRPLKSPQNETLYSVLKA                                                   281 - 303
//

Text Mined References (20)

PMID Year Title
24889612 2014 Structural basis for simultaneous recognition of an O-glycan and its attached peptide of mucin family by immune receptor PILR?.
24843130 2014 PILR? and PILR? have a siglec fold and provide the basis of binding to sialic acid.
24253495 2014 Identification of paired immunoglobulin-like type 2 receptor ? as hepatitis B virus DNA polymerase transactivated protein 1 interacting proteins.
23302878 2013 The amino terminus of herpes simplex virus 1 glycoprotein K is required for virion entry via the paired immunoglobulin-like type-2 receptor alpha.
22695228 2012 Amino acid differences in glycoproteins B (gB), C (gC), H (gH) and L (gL) are associated with enhanced herpes simplex virus type-1 (McKrae) entry via the paired immunoglobulin-like type-2 receptor ?.
22396535 2012 Evolutionarily conserved paired immunoglobulin-like receptor ? (PILR?) domain mediates its interaction with diverse sialylated ligands.
21241660 2011 PANP is a novel O-glycosylated PILR? ligand expressed in neural tissues.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19457990 2009 Differential effects on cell fusion activity of mutations in herpes simplex virus 1 glycoprotein B (gB) dependent on whether a gD receptor or a gB receptor is overexpressed.
19244335 2009 Entry of herpes simplex virus 1 and other alphaherpesviruses via the paired immunoglobulin-like type 2 receptor alpha.
More...