Property Summary

NCBI Gene PubMed Count 22
PubMed Score 322.41
PubTator Score 238.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease -1.256 4.8e-03
Breast cancer -1.300 3.4e-05
cutaneous lupus erythematosus -1.500 8.5e-03
interstitial cystitis -1.200 1.5e-02
intraductal papillary-mucinous adenoma (... 1.900 6.3e-03
intraductal papillary-mucinous carcinoma... 2.100 4.6e-02
intraductal papillary-mucinous neoplasm ... 4.100 1.3e-04
medulloblastoma, large-cell 1.100 5.6e-04
osteosarcoma 1.867 7.6e-07
ovarian cancer 2.100 2.9e-03
pancreatic cancer 1.400 8.4e-04
psoriasis -1.100 1.3e-03
spina bifida -1.939 2.3e-02

Gene RIF (13)

AA Sequence

MVNLESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFNRQIKTEDLSDSLQQTLSHRPCHLSQGPA      1 - 70
MMSGNQMSGLNASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQPGQQGLQPNLLPFPQQQSGLLLPQ     71 - 140
TGPGLASQAFGHPGLPGSSLEPHLEASQHLPVPKHLPSSGGADEPSDLEELEKFAKTFKQRRIKLGFTQG    141 - 210
DVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAESSPSDPSVSTPSSYPSLSEVFGR    211 - 280
KRKKRTSIETNIRLTLEKRFQDNPKPSSEEISMIAEQLSMEKEVVRVWFCNRRQKEKRINCPVATPIKPP    281 - 350
VYNSRLVSPSGSLGPLSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVNSASSF    351 - 420
NSSGSWYRWNHSTYLH                                                          421 - 436
//

Text Mined References (24)

PMID Year Title