Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
R01 Count 5
Funding $278,585.25
PubMed Score 17.08
PubTator Score 17.17

Knowledge Summary

Patent (7,468)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.200 0.000
cystic fibrosis 1.500 0.000
group 4 medulloblastoma -1.900 0.000
lung cancer 1.200 0.000

Synonym

Accession Q9UKI8 B3KR15 B4DX87 Q14150 Q8N591 Q9NYH2 Q9Y4F6
Symbols PKU-beta

Gene

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (13)

PMID Text
26860083 TLK1B mediated phosphorylation of Rad9 regulates its nuclear/cytoplasmic localization and cell cycle checkpoint
24598821 Data indicate Tousled-like kinases (TLK1) phosphorylation has an impact on cell cycle proteins Asf1a and Asf1b function.
24376897 Tousled-like kinase-dependent phosphorylation of Rad9 plays a role in cell cycle progression and G2/M checkpoint exit.
21647934 TLKs appear to be intimately linked to the pattern of resistance to DNA damage, and specifically double-strand breaks.
21048794 Adenoviral delivery of Tousled kinase protects salivary glands against ionizing radiation damage.
20381954 Silencing of TLK1 enhanced DNA damage induced by cisplatin treatment, suggesting that TLK1 plays a pivotal role for the repair of cisplatin-induced DNA damage.
20016786 ASF1 cellular levels are tightly controlled by distinct pathways and provide a molecular mechanism for post-translational regulation of dASF1 and hASF1a by TLK kinases.
18838128 Our data suggest that human PKU-beta/TLK1 plays an important role in chromosome integrity via the regulation of myosin II dynamics by phosphorylating MRLC during mitosis.
17054786 Studies provide evidence for TLK1B-mediated phosphorylation of Asf1 triggering DNA repair.
16156902 TLK1B promotes the repair of double strand breaks, likely as a consequence of a change in chromatin remodeling capacity that must precede the assembly of repair complexes at the sites of damage
More...

AA Sequence

MSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQELLEARFTGV      1 - 70
ASGSTGSTGSCSVGAKASTNNESSNHSFGSLGSLSDKESETPEKKQSESSRGRKRKAENQNESSQGKSIG     71 - 140
GRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFK    141 - 210
IIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIE    211 - 280
KSTQEKLSSREKSMQDRLRLGHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRK    281 - 350
PPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQLLTLAEYHEQEEIFKLRLGHLKKEEAEIQAE    351 - 420
LERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQRYAAVKIHQLN    421 - 490
KSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEYCEGNDLDFYLKQHKLMSEKE    491 - 560
ARSIVMQIVNALRYLNEIKPPIIHYDLKPGNILLVDGTACGEIKITDFGLSKIMDDDSYGVDGMDLTSQG    561 - 630
AGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVK    631 - 700
PVVSSEAKAFIRRCLAYRKEDRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITY        701 - 766
//

Publication (41)

PMID Year Title
26860083 2016 TLK1B mediated phosphorylation of Rad9 regulates its nuclear/cytoplasmic localization and cell cycle checkpoint.
25416956 2014 A proteome-scale map of the human interactome network.
24598821 2014 Tousled-like kinases phosphorylate Asf1 to promote histone supply during DNA replication.
24376897 2013 Tousled-like kinase-dependent phosphorylation of Rad9 plays a role in cell cycle progression and G2/M checkpoint exit.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
21647934 2011 The expression of Tousled kinases in CaP cell lines and its relation to radiation response and DSB repair.
21269460 2011 Initial characterization of the human central proteome.
21048794 2011 Adenoviral delivery of Tousled kinase for the protection of salivary glands against ionizing radiation damage.
More...