Property Summary

Ligand Count 1
NCBI Gene PubMed Count 33
PubMed Score 19.16
PubTator Score 17.17

Knowledge Summary

Patent (7,468)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Neoplasm Recurrence, Local 37 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
psoriasis 6694 2.3e-05
group 4 medulloblastoma 1855 3.1e-05
cystic fibrosis 1696 2.2e-04
lung cancer 4740 2.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.073 2.2e-04
group 4 medulloblastoma -1.900 3.1e-05
lung cancer 1.200 2.6e-04
psoriasis -2.200 2.3e-05

Gene RIF (14)

AA Sequence

MSVQSSSGSLEGPPSWSQLSTSPTPGSAAAARSLLNHTPPSGRPREGAMDELHSLDPRRQELLEARFTGV      1 - 70
ASGSTGSTGSCSVGAKASTNNESSNHSFGSLGSLSDKESETPEKKQSESSRGRKRKAENQNESSQGKSIG     71 - 140
GRGHKISDYFEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFK    141 - 210
IIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLRRQIDEQQKLLEKYKERLNKCISMSKKLLIE    211 - 280
KSTQEKLSSREKSMQDRLRLGHFTTVRHGASFTEQWTDGFAFQNLVKQQEWVNQQREDIERQRKLLAKRK    281 - 350
PPTANNSQAPSTNSEPKQRKNKAVNGAENDPFVRPNLPQLLTLAEYHEQEEIFKLRLGHLKKEEAEIQAE    351 - 420
LERLERVRNLHIRELKRINNEDNSQFKDHPTLNERYLLLHLLGRGGFSEVYKAFDLYEQRYAAVKIHQLN    421 - 490
KSWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDTFCTVLEYCEGNDLDFYLKQHKLMSEKE    491 - 560
ARSIVMQIVNALRYLNEIKPPIIHYDLKPGNILLVDGTACGEIKITDFGLSKIMDDDSYGVDGMDLTSQG    561 - 630
AGTYWYLPPECFVVGKEPPKISNKVDVWSVGVIFFQCLYGRKPFGHNQSQQDILQENTILKATEVQFPVK    631 - 700
PVVSSEAKAFIRRCLAYRKEDRFDVHQLANDPYLLPHMRRSNSSGNLHMAGLTASPTPPSSSIITY        701 - 766
//

Text Mined References (42)

PMID Year Title