Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.27
PubTator Score 4.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma 2.629 4.8e-02
interstitial cystitis 2.300 3.5e-03
lung adenocarcinoma 1.100 1.3e-06
nasopharyngeal carcinoma -1.500 2.7e-05
osteosarcoma -1.284 3.6e-03
psoriasis 1.200 2.1e-04

Synonym

Accession Q9UKI3 B2R587
Symbols 8HS20
N27C7-2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY      1 - 70
YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP                      71 - 123
//

Text Mined References (15)

PMID Year Title