Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.27
PubTator Score 4.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.200 0.000
osteosarcoma -1.284 0.004
interstitial cystitis 2.300 0.003
aldosterone-producing adenoma 2.629 0.048
lung adenocarcinoma 1.100 0.000
nasopharyngeal carcinoma -1.500 0.000

Gene RIF (7)

PMID Text
25861052 A possible role for VPREB3 in aldosterone biosynthesis.
25861052 levels of VPREB3 mRNA in aldosterone-producing adenomas directly correlate to plasma aldosterone concentrations in peripheral blood of respective patients
24493312 the combined immunohistochemical detection of VPREB3 and ID3 is applicable to the routine diagnostic in case of mature aggressive B-cell lymphomas.
20823132 Data show that the absence of VpreB3 is virtually always associated with wild-type c-MYC alleles.
15757909 the present study confirms the co-existence of surrogate lambda and kappa receptors that are proposed to work in concert to promote B lymphocyte maturation.
14670953 VpreB3 may play a role in the regulation of the maturation and secretion of free IgLC in chicken B cells
8491176 mouse VpreB3 associates with mu heavy chains early in pre-B cell receptor biosynthesis

AA Sequence

MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLY      1 - 70
YRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP                      71 - 123
//

Publication (15)

PMID Year Title
25861052 2015 Pre-B Lymphocyte Protein 3 (VPREB3) Expression in the Adrenal Cortex: Precedent for non-Immunological Roles in Normal and Neoplastic Human Tissues.
24493312 2014 The combined expression of VPREB3 and ID3 represents a new helpful tool for the routine diagnosis of mature aggressive B-cell lymphomas.
20823132 2010 The pre-B-cell receptor associated protein VpreB3 is a useful diagnostic marker for identifying c-MYC translocated lymphomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15757909 2005 Assembly of the kappa preB receptor requires a V kappa-like protein encoded by a germline transcript.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14670953 2004 Binding of free immunoglobulin light chains to VpreB3 inhibits their maturation and secretion in chicken B cells.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...