Property Summary

NCBI Gene PubMed Count 28
Grant Count 5
R01 Count 3
Funding $661,660.8
PubMed Score 35.26
PubTator Score 18.81

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKI2 B2R8S0 O95353 Q9UQJ0
Symbols UB1
CEP3
BORG2

Gene

Gene RIF (2)

PMID Text
20385374 The expression of CDC42EP3 mRNA was significantly increased by 19.7% in dorsal prefrontal cortex in patient with schizophrenia.
18854154 Knockdown of CDC42 effector protein 3 (CDC42EP3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQGNYELLPGNQ      1 - 70
EKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALMLPLLSPVTFNSKQESFGPAKL     71 - 140
PRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQSSQGRDSHSSSLSEQYPDWPAEDMFDHPTP    141 - 210
CELIKGKTKSEESLSDLTGSLLSLQLDLGPSLLDEVLNVMDKNK                              211 - 254
//

Publication (31)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681909 2012 Genes responsible for the characteristics of primary cultured invasive phenotype hepatocellular carcinoma cells.
22451153 2012 Identification and characterization of genes related to the development of breast muscles in Pekin duck.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20385374 2010 Altered cortical CDC42 signaling pathways in schizophrenia: implications for dendritic spine deficits.
17692555 2007 The intracellular form of human MAGP1 elicits a complex and specific transcriptional response.
More...