Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
R01 Count 2
Funding $99,840.88
PubMed Score 33.16
PubTator Score 19.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 0.031
ovarian cancer -1.100 0.000

Synonym

Accession Q9UKG4 A4D1Q4 Q8N631
Symbols NAS2
SUT1
SUT-1

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (4)

PMID Text
23485456 To investigate the regulation of SLC13A4 gene expression, we analysed the transcriptional activity of the SLC13A4 5'-flanking region in the JEG-3 placental cell line using luciferase reporter assays.
23453247 SLC13A4 and SLC26A2 were the most abundant sulfate transporter mRNAs, which localized to syncytiotrophoblast and cytotrophoblast cells, respectively.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15607730 Here, we characterized the functional properties of the human Na(+)-sulfate cotransporter (hNaS2), determined its tissue distribution, and identified its gene (SLC13A4) structure.

AA Sequence

MGLLQGLLRVRKLLLVVCVPLLLLPLPVLHPSSEASCAYVLIVTAVYWVSEAVPLGAAALVPAFLYPFFG      1 - 70
VLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKPGMLLLCFMCCTTLLSMWLSN     71 - 140
TSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNE    141 - 210
NLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGG    211 - 280
LTTIIGTSTSLIFLEHFNNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKK    281 - 350
KTKREQLSEKRIQEEYEKLGDISYPEMVTGFFFILMTVLWFTREPGFVPGWDSFFEKKGYRTDATVSVFL    351 - 420
GFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGSKSSGLSTWIG    421 - 490
NQMLSLSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLHINPLYTLIPVTMCISFAVML    491 - 560
PVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAINTWGVSLFHLDTYPAWARVSNITDQA        561 - 626
//

Text Mined References (10)

PMID Year Title
23485456 2013 Molecular analysis of the human SLC13A4 sulfate transporter gene promoter.
23453247 2013 Human placental sulfate transporter mRNA profiling from term pregnancies identifies abundant SLC13A4 in syncytiotrophoblasts and SLC26A2 in cytotrophoblasts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16211368 2006 Molecular properties of the SLC13 family of dicarboxylate and sulfate transporters.
15607730 2005 Functional characterization and genomic organization of the human Na(+)-sulfate cotransporter hNaS2 gene (SLC13A4).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10535998 1999 Molecular cloning and functional analysis of SUT-1, a sulfate transporter from human high endothelial venules.