Property Summary

NCBI Gene PubMed Count 9
PubMed Score 37.45
PubTator Score 19.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Liver Cirrhosis 181 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 6.4e-05
group 3 medulloblastoma 4104 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Diastrophic dysplasia 21 4.036 2.0
Ganglioneuroma 13 3.422 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.200 3.1e-02
ovarian cancer -1.100 6.4e-05

Gene RIF (5)

AA Sequence

MGLLQGLLRVRKLLLVVCVPLLLLPLPVLHPSSEASCAYVLIVTAVYWVSEAVPLGAAALVPAFLYPFFG      1 - 70
VLRSNEVAAEYFKNTTLLLVGVICVAAAVEKWNLHKRIALRMVLMAGAKPGMLLLCFMCCTTLLSMWLSN     71 - 140
TSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNE    141 - 210
NLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGG    211 - 280
LTTIIGTSTSLIFLEHFNNQYPAAEVVNFGTWFLFSFPISLIMLVVSWFWMHWLFLGCNFKETCSLSKKK    281 - 350
KTKREQLSEKRIQEEYEKLGDISYPEMVTGFFFILMTVLWFTREPGFVPGWDSFFEKKGYRTDATVSVFL    351 - 420
GFLLFLIPAKKPCFGKKNDGENQEHSLGTEPIITWKDFQKTMPWEIVILVGGGYALASGSKSSGLSTWIG    421 - 490
NQMLSLSSLPPWAVTLLACILVSIVTEFVSNPATITIFLPILCSLSETLHINPLYTLIPVTMCISFAVML    491 - 560
PVGNPPNAIVFSYGHCQIKDMVKAGLGVNVIGLVIVMVAINTWGVSLFHLDTYPAWARVSNITDQA        561 - 626
//

Text Mined References (11)

PMID Year Title