Property Summary

NCBI Gene PubMed Count 74
PubMed Score 511.01
PubTator Score 67.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
aldosterone-producing adenoma -1.282 1.4e-02
osteosarcoma 3.176 1.8e-07
ovarian cancer -1.900 6.4e-06
Waldenstrons macroglobulinemia -1.284 9.7e-03

Protein-protein Interaction (1)

Gene RIF (53)

AA Sequence

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK      1 - 70
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDH     71 - 140
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF    141 - 210
FKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRK    211 - 280
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK    281 - 350
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP    351 - 420
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK    421 - 490
SETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQ    491 - 560
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE    561 - 630
LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGE    631 - 700
GGKKRESEA                                                                 701 - 709
//

Text Mined References (86)

PMID Year Title