Property Summary

NCBI Gene PubMed Count 71
Grant Count 107
R01 Count 56
Funding $15,085,959.8
PubMed Score 491.62
PubTator Score 67.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.284 0.010
osteosarcoma 3.176 0.000
aldosterone-producing adenoma -1.282 0.014
ovarian cancer -1.900 0.000

Synonym

Accession Q9UKG1 Q9P2B9 Dip13-alpha
Symbols APPL
MODY14
DIP13alpha

Gene

PDB

2EJ8   2ELA   2ELB   2Q12   2Q13   2Z0N   2Z0O   5C5B  

Gene RIF (50)

PMID Text
26731990 article provides evidence that GG genotype and G carrier (CG+GG) genotypes of the rs4640525 polymorphism in the APPL1 gene may be suitable susceptibility biomarkers for NAFLD
26583432 Data show that signal transducing adaptor proteins APPL1 and APPL2 are required for TGFbeta-induced nuclear translocation of TGFbeta type I receptor (TbetaRI)-ICD and for cancer cell invasiveness of prostate and breast cancer cell lines.
26473288 Low expression of APPL1 is associated with metastasis in prostate cancer.
26459602 APPL1 endosomes represent a distinct population of Rab5-positive sorting endosomes.
26073777 Two loss-of-function mutations in APPL1, identified by means of whole-exome sequencing, found in two large families with a high prevalence of Familial Diabetes Mellitus.
25780039 A role for APPL1 in TLR3/4-dependent TBK1 and IKKepsilon activation in macrophages.
25622892 APPL1 is a positive regulator of Dvl2-dependent transcriptional activity of AP-1.
24813896 APPL1 sensitizes insulin signaling by acting at a site downstream of the IR. Study uncovers a mechanism regulating insulin signaling and crosstalk between the insulin and adiponectin pathways.
24763056 ATM is the central modulator of APPL-mediated effects on radiosensitivity and DNA repair.
23986476 The activated EGF receptor enters distinct sub-populations of SNX15- and APPL1-labelled peripheral endocytic vesicles.
More...

AA Sequence

MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEK      1 - 70
QRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDH     71 - 140
DAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISF    141 - 210
FKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNRNLTRK    211 - 280
AGYLNARNKTGLVSSTWDRQFYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGK    281 - 350
KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAAGQSRP    351 - 420
PTARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGRRTNPFGESGGSTK    421 - 490
SETEDSILHQLFIVRFLGSMEVKSDDHPDVVYETMRQILAARAIHNIFRMTESHLLVTCDCLKLIDPQTQ    491 - 560
VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAE    561 - 630
LDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGE    631 - 700
GGKKRESEA                                                                 701 - 709
//

Text Mined References (83)

PMID Year Title
26731990 2015 Association of APPL1 Gene Polymorphism with Non-Alcoholic Fatty Liver Disease Susceptibility in a Chinese Han Population.
26583432 2016 APPL proteins promote TGF?-induced nuclear transport of the TGF? type I receptor intracellular domain.
26473288 2015 Endosomal gene expression: a new indicator for prostate cancer patient prognosis?
26459602 2015 APPL endosomes are not obligatory endocytic intermediates but act as stable cargo-sorting compartments.
26073777 2015 Loss-of-Function Mutations in APPL1 in Familial Diabetes Mellitus.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25780039 2015 A role for APPL1 in TLR3/4-dependent TBK1 and IKK? activation in macrophages.
25622892 2015 APPL1 endocytic adaptor as a fine tuner of Dvl2-induced transcription.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...