Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.39
PubTator Score 8.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.88310415267458E-16
lung carcinoma 2844 1.07794707923E-12
ulcerative colitis 2087 2.66846264560295E-10
posterior fossa group A ependymoma 1511 2.36011671463619E-7
malignant mesothelioma 3163 9.58765554294326E-7
psoriasis 6685 2.11986873407713E-6
group 4 medulloblastoma 1875 1.11985564697777E-5
hepatocellular carcinoma 550 4.82872621147942E-5
pediatric high grade glioma 2712 1.13255146914736E-4
cystic fibrosis 1670 1.16628195810703E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.73456775480576E-4
glioblastoma 5572 6.34794409981486E-4
medulloblastoma, large-cell 6234 9.71677758973283E-4
osteosarcoma 7933 0.00113056482832615
active Crohn's disease 918 0.00446795859616311
atypical teratoid / rhabdoid tumor 4369 0.00927460952438639
pituitary cancer 1972 0.0125690317656994
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0156805093049123
gastric carcinoma 832 0.0247259677637396
subependymal giant cell astrocytoma 2287 0.0253021135045346
diabetes mellitus 1663 0.0292658710511205
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0488614487227572
Disease Target Count Z-score Confidence
Retinal Degeneration 49 3.082 1.5

Expression

Synonym

Accession Q9UKF7 A8K473 J3QR20 Q96I07
Symbols RDGBB
RDGBB1
MRDGBbeta
RDGB-BETA
M-RDGB-beta

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (4)

PMID Text
26977884 PITPNC1-mediated vesicular release.
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22822086 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).

AA Sequence

MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPS      1 - 70
WARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDI     71 - 140
ACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRD    141 - 210
ILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPL    211 - 280
STDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE                      281 - 332
//

Text Mined References (19)

PMID Year Title
26977884 2016 PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
24503447 2014 Genome-wide association study to characterize serum bilirubin elevations in patients with HCV treated with GS-9256, an HCV NS3 serine protease inhibitor.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17543578 2007 RdgB proteins: functions in lipid homeostasis and signal transduction.
More...