Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.39
PubTator Score 8.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9UKF7 A8K473 J3QR20 Q96I07
Symbols RDGBB
RDGBB1
MRDGBbeta
RDGB-BETA
M-RDGB-beta

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
26977884 PITPNC1-mediated vesicular release.
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22822086 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid
21728994 The phosphatidylinositol transfer protein RdgBbeta binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).

AA Sequence

MLLKEYRICMPLTVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRVYLNSKLPS      1 - 70
WARAVVPKIFYVTEKAWNYYPYTITEYTCSFLPKFSIHIETKYEDNKGSNDTIFDNEAKDVEREVCFIDI     71 - 140
ACDEIPERYYKESEDPKHFKSEKTGRGQLREGWRDSHQPIMCSYKLVTVKFEVWGLQTRVEQFVHKVVRD    141 - 210
ILLIGHRQAFAWVDEWYDMTMDEVREFERATQEATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPL    211 - 280
STDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCRPKSE                      281 - 332
//

Publication (19)

PMID Year Title
26977884 2016 PITPNC1 Recruits RAB1B to the Golgi Network to Drive Malignant Secretion.
25416956 2014 A proteome-scale map of the human interactome network.
24503447 2014 Genome-wide association study to characterize serum bilirubin elevations in patients with HCV treated with GS-9256, an HCV NS3 serine protease inhibitor.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22822086 2012 Phosphatidylinositol transfer protein, cytoplasmic 1 (PITPNC1) binds and transfers phosphatidic acid.
21728994 2011 The phosphatidylinositol transfer protein RdgB? binds 14-3-3 via its unstructured C-terminus, whereas its lipid-binding domain interacts with the integral membrane protein ATRAP (angiotensin II type I receptor-associated protein).
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17543578 2007 RdgB proteins: functions in lipid homeostasis and signal transduction.
More...