Property Summary

Ligand Count 109
NCBI Gene PubMed Count 33
PubMed Score 28.55
PubTator Score 15.03

Knowledge Summary

Patent (61,164)


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.1
Schizophrenia 1160 0.0 0.9
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0


  Differential Expression (21)

Gene RIF (14)

AA Sequence

NDKVFFASVRSGGSSQVFFMTLNRNSMMNW                                           1331 - 1360

Text Mined References (46)

PMID Year Title