Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
R01 Count 4
Funding $185,398.63
PubMed Score 26.00
PubTator Score 15.03

Knowledge Summary

Patent (61,164)




2X7F   5AX9   5CWZ   5D7A  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

26645429 Endogenous substrates of TNIK were identified in neurons, along with consensus sequences for TNIK.
26499327 High expression of TNIK in colorectal cancer was associated with recurrence in stage II and III colorectal cancer patients.
25160513 nuclear p-TNIK expression was studied in hepatocellular carcinoma, and p-TNIK nuclear expression was associated with poor prognosis and is a candidate prognostic marker for hepatocellular carcinoma
23355318 Dynamic change of TNIK offers a way to protect cells from outside stimulus.
22904686 TNIK mediates proliferation and survival of EBV-transformed B-cells.
21710359 TNIK is essential for the activation of both the canonical Wnt pathway and the JNK pathway, and serves as a pro-survival factor.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15342639 TNIK is a specific effector of Rap2 to regulate actin cytoskeleton

AA Sequence

NDKVFFASVRSGGSSQVFFMTLNRNSMMNW                                           1331 - 1360

Text Mined References (42)

PMID Year Title
26645429 2016 Identification of Phosphorylation Consensus Sequences and Endogenous Neuronal Substrates of the Psychiatric Risk Kinase TNIK.
26499327 2015 Prognostic significance of Traf2- and Nck- interacting kinase (TNIK) in colorectal cancer.
25160513 2014 Nuclear expression of phosphorylated TRAF2- and NCK-interacting kinase in hepatocellular carcinoma is associated with poor prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23355318 2013 Dynamic change of TNIK in response to tumor necrosis factor alpha in a TRAF2-dependent manner.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22904686 2012 The germinal center kinase TNIK is required for canonical NF-?B and JNK signaling in B-cells by the EBV oncoprotein LMP1 and the CD40 receptor.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21710359 2011 Enormous influence of TNIK knockdown on intracellular signals and cell survival.