Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.17
PubTator Score 22.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.900 7.2e-05
astrocytic glioma -1.100 5.0e-03
atypical teratoid / rhabdoid tumor -2.300 3.1e-05
ependymoma -1.400 3.2e-02
glioblastoma -1.200 5.0e-03
group 3 medulloblastoma -2.200 1.2e-03
intraductal papillary-mucinous adenoma (... -1.100 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.200 4.9e-02
lung cancer 1.700 6.4e-05
malignant mesothelioma 3.600 1.4e-07
medulloblastoma, large-cell -1.800 8.0e-04
oligodendroglioma -1.500 1.7e-02
pituitary cancer 2.200 4.5e-05
primitive neuroectodermal tumor -1.400 1.0e-02

Gene RIF (17)

AA Sequence

MWIQQLLGLSSMSIRWPGRPLGSHAWILIAMFQLAVDLPACEALGPGPEFWLLPRSPPRPPRLWSFRSGQ      1 - 70
PARVPAPVWSPRPPRVERIHGQMQMPRARRAHRPRDQAAALVPKAGLAKPPAAAKSSPSLASSSSSSSSA     71 - 140
VAGGAPEQQALLRRGKRHLQGDGLSSFDSRGSRPTTETEFIAWGPTGDEEALESNTFPGVYGPTTVSILQ    141 - 210
TRKTTVAATTTTTTTATPMTLQTKGFTESLDPRRRIPGGVSTTEPSTSPSNNGEVTQPPRILGEASGLAV    211 - 280
HQIITITVSLIMVIAALITTLVLKNCCAQSGNTRRNSHQRKTNQQEESCQNLTDFPSARVPSSLDIFTAY    281 - 350
NETLQCSHECVRASVPVYTDETLHSTTGEYKSTFNGNRPSSSDRHLIPVAFVSEKWFEISC             351 - 411
//

Text Mined References (24)

PMID Year Title