Property Summary

NCBI Gene PubMed Count 10
Grant Count 8
R01 Count 8
Funding $406,701.53
PubMed Score 4.24
PubTator Score 6.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
nephrosclerosis -1.153 0.016
malignant mesothelioma -1.900 0.000
astrocytoma -1.800 0.000
ependymoma -3.300 0.042
oligodendroglioma -1.300 0.031
uncontrolled asthma 1.400 0.008
glioblastoma -2.600 0.000
osteosarcoma -1.103 0.001
group 3 medulloblastoma -1.900 0.012
cystic fibrosis 1.699 0.000
atypical teratoid / rhabdoid tumor -3.600 0.000
primitive neuroectodermal tumor -1.700 0.042
adrenocortical carcinoma -2.104 0.005
pancreatic ductal adenocarcinoma liver m... -2.704 0.001
non-small cell lung cancer 1.250 0.000
intraductal papillary-mucinous adenoma (... -1.700 0.027
lung cancer 2.500 0.002
active Crohn's disease 1.801 0.015
interstitial cystitis 1.200 0.004
adult high grade glioma -2.500 0.000
subependymal giant cell astrocytoma -2.757 0.001
lung adenocarcinoma 1.718 0.004
lung carcinoma 4.700 0.000
Pick disease -1.200 0.005
invasive ductal carcinoma 2.900 0.041
ulcerative colitis 1.300 0.000
ovarian cancer -1.800 0.000
pituitary cancer -1.300 0.000
chronic rhinosinusitis 1.180 0.049

Gene RIF (5)

PMID Text
25805104 High expression of DNAJC12 correlates with poor prognosis for rectal cancer.
24122553 the endogenous DNAJC12 and Hsc70 proteins interact in LNCaP cells.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16391838 JDP1 is a estrogen target gene and that its expression might be used as a marker of the estrogen transactivation activity
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE      1 - 70
SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL     71 - 140
ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI                141 - 198
//

Text Mined References (14)

PMID Year Title
25805104 2015 Overexpression of DNAJC12 predicts poor response to neoadjuvant concurrent chemoradiotherapy in patients with rectal cancer.
24122553 2014 The co-chaperone DNAJC12 binds to Hsc70 and is upregulated by endoplasmic reticulum stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16391838 2006 JDP1 (DNAJC12/Hsp40) expression in breast cancer and its association with estrogen receptor status.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
More...