Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.56
PubTator Score 6.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
active Crohn's disease 1.801 1.5e-02
adrenocortical carcinoma -2.104 4.6e-03
adult high grade glioma -2.000 2.0e-04
astrocytic glioma -1.700 7.4e-03
atypical teratoid / rhabdoid tumor -3.600 8.3e-07
chronic rhinosinusitis 1.180 4.9e-02
cystic fibrosis 1.699 6.1e-06
ependymoma -3.300 4.2e-02
glioblastoma -1.700 9.2e-05
group 3 medulloblastoma -1.900 1.2e-02
interstitial cystitis 1.200 4.4e-03
intraductal papillary-mucinous adenoma (... -1.700 2.7e-02
invasive ductal carcinoma 2.900 4.1e-02
lung adenocarcinoma 1.718 4.3e-03
lung cancer 2.500 1.7e-03
lung carcinoma 4.700 1.7e-50
malignant mesothelioma -1.900 1.7e-06
nephrosclerosis -1.153 1.6e-02
non-small cell lung cancer 1.173 1.4e-03
oligodendroglioma -1.300 3.1e-02
osteosarcoma -1.103 1.4e-03
ovarian cancer -1.800 4.5e-06
pancreatic ductal adenocarcinoma liver m... -2.704 5.4e-04
Pick disease -1.200 5.1e-03
pituitary cancer -1.300 1.2e-06
primitive neuroectodermal tumor -1.700 4.2e-02
subependymal giant cell astrocytoma -2.401 2.3e-03
ulcerative colitis 1.300 3.8e-04
uncontrolled asthma 1.400 7.7e-03

Gene RIF (7)

AA Sequence

MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE      1 - 70
SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL     71 - 140
ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI                141 - 198
//

Text Mined References (16)

PMID Year Title