Property Summary

NCBI Gene PubMed Count 39
Grant Count 4
Funding $19,076
PubMed Score 5.61
PubTator Score 6.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 0.011
ependymoma 1.100 0.014
oligodendroglioma 1.500 0.003
psoriasis 1.300 0.000
osteosarcoma 2.341 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
glioblastoma 1.300 0.028
group 4 medulloblastoma 1.800 0.005
medulloblastoma, large-cell 2.300 0.000
Pick disease -1.100 0.000
ovarian cancer -1.500 0.000
dermatomyositis -1.200 0.000

Synonym

Accession Q9UKB1 B2RC98 Q9P2S8 Q9P2S9 Q9Y4C6
Symbols Hos
BTRC2
FBW1B
Fbw11
BTRCP2
FBXW1B

Gene

Gene RIF (10)

PMID Text
25332235 SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1
23611780 Data indicate that miR-106b-25 cluster (miR-106b, miR-93 and miR-25) targets the 3'UTR of the beta-TRCP2 transcript and increases the expression of Snail.
22851693 Knockdown of beta-TrCP1 and beta-TrCP2 attenuated the K48-linked ubiquitination and degradation of IRAK1.
22190034 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22045853 Data indicate that knockdown of beta-TrCP1 and beta-TrCP2 markedly reduced IL-17-induced, phosphorylation-dependent ubiquitination and degradation of Act1.
21138764 two splice variants of beta-transducin repeat containing protein 2 (BTRCP2) localise exclusively to either the nucleus or the cytosol.
18187620 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 Knockdown of F-box and WD repeat domain containing 11 (FBXW11) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17121803 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16865294 FBXW11 may be the most likely candidate gene for the Holoprosencephaly and prexial polydactyly phenotype.

AA Sequence

MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQ      1 - 70
KEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLD     71 - 140
ARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYP    141 - 210
KIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHT    211 - 280
GSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASA    281 - 350
TDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS    351 - 420
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVE    421 - 490
HSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR                      491 - 542
//

Text Mined References (49)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25332235 2015 Substrate trapping proteomics reveals targets of the ?TrCP2/FBXW11 ubiquitin ligase.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23611780 2013 MicroRNA-106b-25 cluster targets ?-TRCP2, increases the expression of Snail and enhances cell migration and invasion in H1299 (non small cell lung cancer) cells.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22851693 2012 ?-TrCP-mediated IRAK1 degradation releases TAK1-TRAF6 from the membrane to the cytosol for TAK1-dependent NF-?B activation.
22682247 2012 Wnt signaling through inhibition of ?-catenin degradation in an intact Axin1 complex.
22045853 2011 Persistent stimulation with interleukin-17 desensitizes cells through SCF?-TrCP-mediated degradation of Act1.
More...