Property Summary

NCBI Gene PubMed Count 44
PubMed Score 5.88
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 1.1e-02
atypical teratoid / rhabdoid tumor 1.900 1.9e-04
dermatomyositis -1.200 4.5e-04
ependymoma 1.100 1.4e-02
glioblastoma 1.300 2.8e-02
group 4 medulloblastoma 1.800 4.8e-03
medulloblastoma, large-cell -1.300 3.1e-04
oligodendroglioma 1.500 2.8e-03
osteosarcoma 2.341 5.4e-06
ovarian cancer -1.500 6.9e-05
Pick disease -1.100 6.8e-06
psoriasis 1.300 1.6e-08

Gene RIF (10)

AA Sequence

MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQ      1 - 70
KEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLD     71 - 140
ARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYP    141 - 210
KIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHT    211 - 280
GSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASA    281 - 350
TDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS    351 - 420
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVE    421 - 490
HSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR                      491 - 542
//

Text Mined References (54)

PMID Year Title