1. Home
  2. Targets
  3. signaling molecule
  4. Calcipressin-3

Tbio Calcipressin-3

Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development (By similarity).

 Comments

Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.75
PubTator Score 8.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 5.79429991160663E-19
malignant mesothelioma 3163 8.33339940541736E-8
posterior fossa group B ependymoma 1530 6.92759764665622E-7
sarcoidosis 368 8.62576504029581E-6
cystic fibrosis 1670 1.07751125502187E-4
group 4 medulloblastoma 1875 6.0813588952412E-4
lung cancer 4473 8.94429840933608E-4
ovarian cancer 8492 0.00294161255165271
astrocytic glioma 2241 0.0079153096769723
subependymal giant cell astrocytoma 2287 0.0105013953225432
invasive ductal carcinoma 2950 0.0139416772967712
pilocytic astrocytoma 3086 0.0141750255975025
Breast cancer 3099 0.02270138094331
pediatric high grade glioma 2712 0.0259643018503408
acute myeloid leukemia 785 0.0366766161359344
progressive supranuclear palsy 674 0.0369479894169151
Disease Target Count Z-score Confidence
Down syndrome 548 3.818 1.9

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.700 0.000
astrocytic glioma -2.500 0.008
group 4 medulloblastoma 2.300 0.001
cystic fibrosis 1.093 0.000
lung cancer 1.300 0.001
Breast cancer 3.000 0.023
pediatric high grade glioma -1.300 0.026
pilocytic astrocytoma -1.300 0.014
posterior fossa group B ependymoma 1.600 0.000
sarcoidosis -1.300 0.000
subependymal giant cell astrocytoma -3.596 0.011
lung carcinoma 1.500 0.000
progressive supranuclear palsy -1.100 0.037
invasive ductal carcinoma 1.200 0.014
acute myeloid leukemia 1.500 0.037
ovarian cancer 1.300 0.003

Synonym

Accession Q9UKA8 A4GU14 A4LA69 E3VWE2 E5L4P0 E5L4P7 E7ENV1 E7EWD8 G1FI66 G1FLF0 Q5ECL3 Q5TGC6 Q9NUC8 Q9UKA7
Symbols RCN3
MCIP3
hRCN3
DSCR1L2

Gene

RCAN3

PANTHER Protein Class (1)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

 GO Function (4)

 GO Component (1)

 GO Process (3)

 Compartment GO Term (8)

 HCA RNA Cell Line (56)

See all...

 UniProt Keyword (4)

Gene RIF (8)

PMID Text
25916653 The tumor suppressor effect of RCAN3 in breast cancer depends on the interaction with calcineurin.
21961037 Studies indicate that RCAN3 is composed of a multigene system that includes at least 21 alternative spliced isoforms.
21042787 Data shows RCAN3 inhibits HUVEC proliferation both basally and under VEGF or phorbol 12-myristate 13-acetate-stimulated conditions, however it does not modulate gene expression of the chosen inflammatory genes.
19819266 our data have elucidated the molecular and cellular mechanism whereby PGF(2alpha) regulates CXCL8 expression via the FP receptor in endometrial adenocarcinomas and have highlighted RCAN1-4 as a negative regulator of CXCL8 expression
19074885 Observational study of gene-disease association. (HuGE Navigator)
18022329 The interaction between TNNI3 and the new R variants of RCAN3, RCAN3-2,3,5 and RCAN3-2,4,5, is reported.
17270291 human RCAN3, encoded by the RCAN3 (also known as DSCR1L2) gene, interacts physically and functionally with calcineurin
16516408 The yeast cotransformation and GST fusion protein assay demonstrated the interaction between this new DSCR1L2 variant and the human cardiac troponin I.

AA Sequence 

MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA      1 - 70
LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ     71 - 140
PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE    141 - 210
TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL                                           211 - 241
//

Text Mined References (15)

PMID Year Title
25916653 2015 A novel role for an RCAN3-derived peptide as a tumor suppressor in breast cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
21961037 2011 Complexity of bidirectional transcription and alternative splicing at human RCAN3 locus.
21042787 2010 Human RCAN3 gene expression and cell growth in endothelial cells.
19819266 2009 Prostaglandin F(2alpha)-F-prostanoid receptor regulates CXCL8 expression in endometrial adenocarcinoma cells via the calcium-calcineurin-NFAT pathway.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18022329 2008 Identification and analysis of human RCAN3 (DSCR1L2) mRNA and protein isoforms.
17270291 2007 RCAN3, a novel calcineurin inhibitor that down-regulates NFAT-dependent cytokine gene expression.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...