Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.75
PubTator Score 8.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 1.500 3.7e-02
astrocytic glioma -2.500 7.9e-03
Astrocytoma, Pilocytic -1.300 1.4e-02
Breast cancer 3.000 2.3e-02
cystic fibrosis 1.093 1.1e-04
group 4 medulloblastoma 2.300 6.1e-04
invasive ductal carcinoma 1.200 1.4e-02
lung cancer 1.300 8.9e-04
lung carcinoma 1.500 5.8e-19
malignant mesothelioma -2.700 8.3e-08
ovarian cancer 1.300 2.9e-03
pediatric high grade glioma -1.300 2.6e-02
posterior fossa group A ependymoma 1.200 3.3e-08
progressive supranuclear palsy -1.100 3.7e-02
sarcoidosis -1.300 8.6e-06
subependymal giant cell astrocytoma -3.596 1.1e-02

Synonym

Accession Q9UKA8 A4GU14 A4LA69 E3VWE2 E5L4P0 E5L4P7 E7ENV1 E7EWD8 G1FI66 G1FLF0 Q5ECL3 Q5TGC6 Q9NUC8 Q9UKA7
Symbols RCN3
MCIP3
hRCN3
DSCR1L2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (8)

AA Sequence

MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEA      1 - 70
LFTIYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQ     71 - 140
PVKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEE    141 - 210
TKNPKQKIAQTRRPDPPTAALNEPQTFDCAL                                           211 - 241
//

Text Mined References (15)

PMID Year Title